KEGG   Escherichia coli UM146: UM146_08040Help
Entry
UM146_08040       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgrB
Motif
Other DBs
NCBI-ProteinID: ADN70999
Position
1707827..1707970
Genome map
AA seq 47 aa AA seqDB search
MKKFRWVALVVVVLACLLLWAQVFNMMCDQDVQFFSGICALNQFIPW
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttcgatgggtcgctctggttgtcgtggtgttggcttgcttgctgctttgg
gcgcaggtattcaacatgatgtgcgatcaggatgtgcaatttttcagcggaatttgtgcc
cttaaccagtttatcccgtggtga

DBGET integrated database retrieval system