KEGG   Escherichia coli UM146: UM146_08075Help
Entry
UM146_08075       CDS       T02000                                 

Definition
(GenBank) mannose-specific PTS system protein IID
  KO
K02796  PTS system, mannose-specific IID component
Organism
elu  Escherichia coli UM146
Pathway
elu00051  Fructose and mannose metabolism
elu00520  Amino sugar and nucleotide sugar metabolism
elu01100  Metabolic pathways
elu02060  Phosphotransferase system (PTS)
Module
elu_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UM146_08075
   00520 Amino sugar and nucleotide sugar metabolism
    UM146_08075
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    UM146_08075
Transporters [BR:elu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    UM146_08075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIID-AGA
Motif
Other DBs
NCBI-ProteinID: ADN71006
Position
complement(1711848..1712699)
Genome map
AA seq 283 aa AA seqDB search
MVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNEA
RKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAGVGD
PIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIVKDM
GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMP
GLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLGL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggttgatacaactcaaactaccaccgagaaaaaactcactcaaagtgatattcgtggc
gtcttcctgcgttctaacctctttcagggttcatggaacttcgaacgtatgcaggcactg
ggtttctgcttctctatggtaccggcaattcgtcgcctctaccctgagaacaacgaagct
cgtaaacaggctattcgccgtcacctggagttctttaacacccagccattcgtggctgcg
ccgattctcggcgtaaccctggcactggaagaacagcgtgctaatggcgcagagatcgat
gacggtgctatcaacggcatcaaagtcggtttgatggggccgctggctggtgtaggcgac
ccgatcttctggggaacggtacgtccggtatttgcagcgctgggggctggtatcgcgatg
agcggcagcctgttaggtccgctgctgttcttcatcctgtttaacctggtgcgtctggca
acccgttactacggcgtagcgtatggttactccaaaggtatcgatatcgttaaagatatg
ggtggtggcttcctgcaaaaactgacggaaggggcgtctatcctcggcctgtttgtcatg
ggggcgttggttaataagtggacacatgtcaacatcccactggtggtctctcgcattact
gaccagacgggcaaagaacacgttaccactgtccagactattctggaccagttaatgccg
ggcctggtaccactgctgctgacctttgcttgtatgtggctgttgcgcaaaaaagttaac
ccgctgtggatcatcgttggcttcttcgtcatcggtatcgctggttacgcttgcggcctg
ctgggactgtaa

DBGET integrated database retrieval system