KEGG   Escherichia coli UM146: UM146_08185Help
Entry
UM146_08185       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF488
Motif
Other DBs
NCBI-ProteinID: ADN71028
Position
complement(1733776..1734123)
Genome map
AA seq 115 aa AA seqDB search
MNIQCKRVYDPAEQSDGYRVLVDRLWPRGIKKTDLALDEWDKEITPSTELRKAFHGEVVD
FATFREQYLAELAQHEQEGKRLADIAKKQPLTLLYSAKNTTQNHALVLADWLRSL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcagtgcaaacgcgtttatgatccggctgaacagagcgatggttatcgcgta
ctggtcgaccgcctctggccacgcggtattaaaaaaaccgatttagcccttgatgaatgg
gataaagaaatcacgccgtcaacggagctgcgcaaagcctttcacggcgaagtcgtcgat
tttgcaacctttcgcgagcaatatcttgcagaactggcgcaacacgagcaagaaggaaag
cggctggcagacatcgccaaaaaacagccgctgaccctgctctactcagcaaaaaacacc
acgcagaaccatgcgctggtgctggcagactggctacgtagcttgtga

DBGET integrated database retrieval system