KEGG   Escherichia coli UM146: UM146_08210Help
Entry
UM146_08210       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
  KO
K19055  Ala-tRNA(Pro) deacylase [EC:3.1.1.-]
Organism
elu  Escherichia coli UM146
Brite
Enzymes [BR:elu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     UM146_08210
Transfer RNA biogenesis [BR:elu03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    UM146_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_edit
Motif
Other DBs
NCBI-ProteinID: ADN71033
Position
complement(1736955..1737458)
Genome map
AA seq 167 aa AA seqDB search
MTEMAKGSVTHQRLIALLSQEGANFRVVTHEAVGKCEAVSEIRGTALGQGAKALVCKVKG
NGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLK
LVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNFRRTA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatggctaaaggaagcgtgacgcatcagcggttaatcgctttattatcgcaa
gaaggtgctaacttccgcgtcgttacccatgaagcggtaggtaaatgtgaagcggtgtca
gaaattcgtggcaccgctttaggccagggggctaaggcactggtatgcaaagtcaaaggc
aatggcgtaaatcaacatgttctggcgatcctcgctgccgatcaacaggccgatctgagc
caactcgccagccatataggcggattacgcgcttcgttggccagcccggcggaagtcgat
gaactcacaggctgtgtcttcggcgcgatcccccctttcagcttccatccaaaactcaaa
ctggttgccgaccccctactcttcgaacgatttgatgaaatcgccttcaatgcaggcatg
ctggataaatccgttattttgaaaaccgcggattatttgcgtattgcgcaaccagaactg
gtcaatttccgccgcactgcgtaa

DBGET integrated database retrieval system