KEGG   Escherichia coli UM146: UM146_08215Help
Entry
UM146_08215       CDS       T02000                                 

Definition
(GenBank) putative diguanylate cyclase
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAPES1 GGDEF dCache_1
Motif
Other DBs
NCBI-ProteinID: ADN71034
Position
complement(1737501..1738991)
Genome map
AA seq 496 aa AA seqDB search
MKLHHRMLRHFIAASVIVLTSSFLIFELVASDRAMSAYLRYIVQRADSSFLYDKYQNQSI
AAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTLQTASTDCDTI
VEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNN
WSFLQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDI
NKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVS
LSIDILYFITSSWKSVLFWILTALILLNMVRMHFRLYQNVSRENISDAMTGLYNRKILTP
ELEQRLQKLVQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAI
RLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKA
SDERLYVNKQNKNSRS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaccatagaatgctccggcattttatcgccgcaagtgtcattgtgctgaca
tcttccttccttatttttgaacttgtcgccagtgacagagcaatgagtgcctatctgcgc
tatatcgtgcagagagcagactcctcctttctttatgataagtatcagaatcagagtatt
gccgcgcatgtgatgcgcgctctcgctgctgagcagtcggaagtgtcgccagaacagcgg
cgcgccatctgcgaggcttttgagtctgccaataatacccatggcttaaacctgactgcc
cataaataccctggcttacgcggcacactacaaaccgcatccactgactgtgacacaatt
gtggaagctgctgcactattacccgcttttgatcaggcagtggaaggcaaccgccaccag
gatgattacggttcaggtcttgggatggccgaagagaaatttcactattatctcgatctc
aatgaccgctatgtctatttttatgagccggttaatgttgagtactttgcgatgaataac
tggtccttcctgcagtcaggaagtattggcatcgatcgcaaagatattgaaaaggtattt
accgggcgtaccgtattatcgagcatttaccaggatcagcgtactaaacagaacgtgatg
agtttactgacgccggtatatgtcgcagggcagctaaaagggattgtgctgctggatatt
aacaaaaacaatctgcggaatatcttttacactcatgaccgccctctcctctggcgtttt
ctcaatgtcacgctaactgatacagattcggggcgcgacattatcatcaaccagagcgaa
gataatctgttccagtatgtcagttacgtccatgacttaccgggcggcattcgtgtctcg
ttatccattgatattctttactttatcacgtcttcgtggaaaagcgttctgttctggatt
ttgacggcgttaattttgctgaatatggtgcggatgcacttccgtttataccaaaatgtg
tcgcgagaaaatattagtgatgcgatgactggactgtataatcgcaaaattttaacccct
gaactggagcagcggttgcagaaactggtgcaatccggttcttcggtgatgtttattgca
attgacatggacaagttaaagcaaataaatgacacccttggtcatcaggagggggattta
gcgattacgttattagctcaggcgattaaacaatcgattcgtaaaagtgattatgccatc
cgactcggtggcgatgaattctgcatcattcttgtcgattcgacgccgcaaattgcagca
caactgcctgaacgtatcgaaaaacgtctgcaacatatcgcgccgcagaaagagatcggc
ttctcttccggtatttacgcgatgaaagaaaacgatacgttacatgatgcgtataaagct
tccgatgagcgtttatatgtcaataagcagaacaaaaacagccgttcatga

DBGET integrated database retrieval system