KEGG   Escherichia coli UM146: UM146_08530Help
Entry
UM146_08530       CDS       T02000                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elu  Escherichia coli UM146
Pathway
elu00010  Glycolysis / Gluconeogenesis
elu00030  Pentose phosphate pathway
elu00051  Fructose and mannose metabolism
elu00052  Galactose metabolism
elu00680  Methane metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
elu01230  Biosynthesis of amino acids
Module
elu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM146_08530
   00030 Pentose phosphate pathway
    UM146_08530
   00051 Fructose and mannose metabolism
    UM146_08530
   00052 Galactose metabolism
    UM146_08530
  Energy metabolism
   00680 Methane metabolism
    UM146_08530
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UM146_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ADN71095
Structure
PDB: 

Jmol
Position
complement(1801267..1802196)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctcactcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtattcgaacccggaggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaattgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcattcag
gtggtgccaccaccggtaaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system