KEGG   Escherichia coli UM146: UM146_09640Help
Entry
UM146_09640       CDS       T02000                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
elu  Escherichia coli UM146
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    UM146_09640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM146_09640
  Lipid metabolism
   00071 Fatty acid degradation
    UM146_09640
  Amino acid metabolism
   00350 Tyrosine metabolism
    UM146_09640
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UM146_09640
   00626 Naphthalene degradation
    UM146_09640
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UM146_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2023229..2024239
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggccctggtgttacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctatgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcactacctacaaagccgttaagctgtcaaaaattcgt
ccaggacagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgaacagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaga
attgtgcaggagaaagccggtggcgctcacgcagcggtggtgacagcggtagctaaagct
gcgtttaactcggcggtggatgctgtccgtgcaggtggtcgtgtcgtggctgtcggtctg
ccgccggagtctatgagcctggacatcccacggctggtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgtcaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatatttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcgctaa

DBGET integrated database retrieval system