KEGG   Escherichia coli UM146: UM146_10475Help
Entry
UM146_10475       CDS       T02000                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elu  Escherichia coli UM146
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UM146_10475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM146_10475
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UM146_10475
Enzymes [BR:elu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UM146_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2203001..2204194
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaactaaaattattgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgttttccggatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgaccctgaaagatgcctgtaatgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggtaccgcagctggcccgcatccttacccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaacgaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggtggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggccac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcaaattgaagagtcttactccatt
tctgccgggctggatttcccgtccgtcggcccgcaacatgcgtatctcaacagcactgga
cgcgctgattacgtgtctattaccgacgatgaagccctggaagcctttaaaacgctttgc
ctgcatgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaatcccgaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system