KEGG   Escherichia coli UM146: UM146_11020Help
Entry
UM146_11020       CDS       T02000                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
elu  Escherichia coli UM146
Pathway
elu00900  Terpenoid backbone biosynthesis
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01130  Biosynthesis of antibiotics
Module
elu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UM146_11020 (ipk)
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     UM146_11020 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADN71573
Structure
PDB: 

Jmol
Position
2304160..2305011
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLSTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgaggttgttgatgaaaactgcggcagac
agcgggcgtctttcgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggttctggtggcgttaaatcat
ctctggcaatgcggactaagcatggatgagctggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgtccgtggtcatgccgcctttgccgaaggtgttggcgaaatatta
acgccggtagacccgccagagaaatggtatctggtcgcacaccctggcgtgagtattccg
acgccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system