KEGG   Escherichia coli UM146: UM146_11020Help
Entry
UM146_11020       CDS       T02000                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
elu  Escherichia coli UM146
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:elu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2304160..2305011
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLSTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgaggttgttgatgaaaactgcggcagac
agcgggcgtctttcgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggttctggtggcgttaaatcat
ctctggcaatgcggactaagcatggatgagctggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgtccgtggtcatgccgcctttgccgaaggtgttggcgaaatatta
acgccggtagacccgccagagaaatggtatctggtcgcacaccctggcgtgagtattccg
acgccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system