KEGG   Escherichia coli UM146: UM146_13880Help
Entry
UM146_13880       CDS       T02000                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
elu  Escherichia coli UM146
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM146_13880 (gpmA)
   01230 Biosynthesis of amino acids
    UM146_13880 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM146_13880 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    UM146_13880 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM146_13880 (gpmA)
Enzymes [BR:elu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UM146_13880 (gpmA)
Exosome [BR:elu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UM146_13880 (gpmA)
  Exosomal proteins of melanoma cells
   UM146_13880 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
2864792..2865544
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctattcataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system