KEGG   Escherichia coli UM146: UM146_14010Help
Entry
UM146_14010       CDS       T02000                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
elu  Escherichia coli UM146
Pathway
elu00020  Citrate cycle (TCA cycle)
elu00190  Oxidative phosphorylation
elu00650  Butanoate metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
Module
elu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
elu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UM146_14010 (sdhD)
   00650 Butanoate metabolism
    UM146_14010 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    UM146_14010 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADN72167
Structure
PDB: 

Jmol
Position
complement(2891576..2891923)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system