KEGG   Escherichia coli UM146: UM146_14855Help
Entry
UM146_14855       CDS       T02000                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
elu  Escherichia coli UM146
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    UM146_14855
Enzymes [BR:elu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UM146_14855
   3.1.2  Thioester hydrolases
    3.1.2.-  
     UM146_14855
Lipid biosynthesis proteins [BR:elu01004]
 Fatty acid synthase
  Component type
   UM146_14855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3077320..3077946
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgctagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgcctt
ccggctctgctgaaacagcatcagccgcgctgggtgctggtagaactgggcggcaatgac
ggtttgcgtggttttcagccacaacaaaccgagcaaacgctgcgccagatattgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgcccttttttatggaagaggtctacctcaaaccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system