KEGG   Escherichia coli UM146: UM146_16600Help
Entry
UM146_16600       CDS       T02000                                 

Definition
periplasmic endochitinase
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
elu  Escherichia coli UM146
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UM146_16600
Enzymes [BR:elu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     UM146_16600
    3.2.1.17  lysozyme
     UM146_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3427061..3429763)
Genome map
AA seq 900 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSTSNTPASNTPANGASATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEITQYGNPASCSVKPDN
NGGAVTPVDPTPETPETPVTPTPDNNEPSTPADSSNDYSLQAWSGQEGSEIYHVIFNGNV
YQNAWWVGSEDCPRGTSVENSNNPWRLVRTATAAEMSQYGNPTTCEIDNGGVIIADGFQA
SKAYSANSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVD
GQAYEALFWTQSDNPALIANQNATGSNSRPWKPLGKTQSYSNEELNNAPQFNPETLYASD
TLIRFNGENYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTL
NTIPDLAALAKSHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDV
MLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLNLRVLDFDIEGTWVADQASIERRNLAV
KKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAIC
QSANTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYL
SDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggaagctcatcttcttcaact
tcaaatacgccagcatctaatacgcccgctaatggcgcttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcaaacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcttggtgggtagcctcttctaactgc
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcttgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtcgtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctacaacggcggcatttataagaacgcctggtgggtgggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagcaacccatggcgttatgttcgcgcggca
acggcaacagaaatcactcagtatggtaacccagcctcctgttccgttaagccggataat
aatggcggtgctgtgactccggttgatccaactccggaaacaccggaaactccagttact
ccaactccggataacaacgagccatcaacaccagcggatagcagtaacgattactcactg
caggcgtggagtggccaggaaggcagcgaaatttaccatgttatcttcaatggtaatgtt
tatcagaatgcctggtgggttggttctgaagattgcccgcgtggcaccagtgtagaaaac
tccaataacccatggcgcctcgtgcgtacagctaccgctgcggaaatgagtcagtacggt
aacccgactacctgtgaaattgataatggcggcgtcattattgcggatggtttccaggcc
agcaaagcgtacagcgcgaacagcatcgtagattataacgatgcacattataaaacctct
gtcgatcaagacgcatggggctttgtccccggcggcgataacccgtggaagaaatacgaa
ccggcgaaagcatggtccgcttccaccgtgtacgtgaaaggtgatcgcgttgttgttgat
gggcaggcttatgaagcgctgttctggacgcaaagtgacaaccctgctctgattgcgaac
caaaacgccaccggtagcaatagtcgcccgtggaagccgttaggtaagactcagagctat
agcaacgaagagctgaataatgcgccgcagtttaatccagaaacgctttatgccagtgat
acgctgattcgctttaacggtgagaactacatttctcagagtaaagtgcagaaagtttct
ccttctgacagcaacccgtggcgtgtttttgttgactggaccggaaccaaagagcgcgta
ggtacgccgaagaaagcgtggccgaaacacgtttatgcaccgtatgtcgactttacgctg
aatacgatcccggatttggctgcgctggctaagagtcataacgtcaaccacttcacgctg
gcgtttgtggtgagtaaagatgcgaacacctgtctaccgacatggggtaccgcttacggt
atgcagaattacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggtgatgtg
atgctgtctatcggtggtgctaataatgccccgctggcagcttcctgtaagaacgttgac
gatctaatgcagcattattatgacatcgttgataacctgaacctcagagtcctggacttc
gatatcgaaggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtg
aagaaagtgcaggataaatggaagtcagaaggcaaagatattgctatctggtataccttg
ccaattctgccgacaggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcg
aaaggtgttgagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgt
cagtctgcaaataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgcc
aacctgcattcacaattgaaaggcctccatcccaacaagagcgatgcagaaattgacgct
atgatgggtaccacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctc
tctgatgctcgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatc
tggtcaatcgcgcgcgacctgccaggcggcactaacctgtctccggaattccacggcctg
actaaagaacaggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaa
taa

DBGET integrated database retrieval system