KEGG   Escherichia coli UM146: UM146_18950Help
Entry
UM146_18950       CDS       T02000                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
elu  Escherichia coli UM146
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UM146_18950
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     UM146_18950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3940208..3941152
Genome map
AA seq 314 aa AA seqDB search
MDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIGIHAG
ANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPD
ELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNG
EGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSV
PWREEIDAFLDRQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggcagcattaatgct
gaccacattcttaatcttcaatcttttcctactccaggcgaaaccgtaaccggtaaccac
tatcaggttgcatttggcggcaaaggcgcgaatcaagctgtggctgctgggcgtagcggt
gcgaatatcgcgtttattgcctgtacgggtgatgacagcattggcgagagcgtacgtcag
cagctcgccactgataacatcgatatttctccggtcagcgtgatcaaaggcgaatcaaca
ggtgtggcgctgatttttgttaatggtgaaggtgagaatgtcatcggtattcatgccggc
gctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcg
tcggcattattaatgcagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatc
gcccatcaaaataagactatcgttgcgcttaacccggctccggctcgcgaacttcctgac
gaacttctggcgctggtggacattattacgccaaacgaaacggaagcagaaaagctcacc
ggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaa
ggtatccgtactgtactgattactttaggaagtcgtggtgtatgggctagcgtgaatggt
gaaggtcagcgcgttcctggattccgggtgcaggctgtcgataccattgctgccggagat
acctttaacggcgcgttaatcacggcgttgctggaagaaaaaccattgccagaggcgatt
cgttttgcccatgcagccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgta
ccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system