KEGG   Escherichia coli UM146: UM146_19825Help
Entry
UM146_19825       CDS       T02000                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
elu  Escherichia coli UM146
Pathway
elu00010  Glycolysis / Gluconeogenesis
elu00051  Fructose and mannose metabolism
elu00562  Inositol phosphate metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
elu01230  Biosynthesis of amino acids
Module
elu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elu_M00002  Glycolysis, core module involving three-carbon compounds
elu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UM146_19825 (tpiA)
   00051 Fructose and mannose metabolism
    UM146_19825 (tpiA)
   00562 Inositol phosphate metabolism
    UM146_19825 (tpiA)
Enzymes [BR:elu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UM146_19825 (tpiA)
Exosome [BR:elu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UM146_19825 (tpiA)
  Exosomal proteins of bladder cancer cells
   UM146_19825 (tpiA)
  Exosomal proteins of melanoma cells
   UM146_19825 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN73297
Structure
PDB: 

Jmol
Position
complement(4128986..4129753)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtatctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggt
ctgactccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaactgaa
gaagtttgtgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacattgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcggaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgccgtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system