KEGG   Escherichia coli UM146: UM146_19860Help
Entry
UM146_19860       CDS       T02000                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
elu  Escherichia coli UM146
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UM146_19860 (glpK)
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UM146_19860 (glpK)
Exosome [BR:elu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UM146_19860 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4133996..4135441)
Genome map
AA seq 481 aa AA seqDB search
MDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGIT
NQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTK
VKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDWD
DKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAGDQQAALFGQLCVKEGM
AKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNYALEGAVFMAGASIQWLRDEM
KLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRAT
LESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTA
LGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWEEHD
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctaccca
aaaccaggctgggtagaacacgacccaatggaaatctgggccacccaaagctccacgctg
gtagaagtgctggcgaaagccgatatcagttccgatcagattgcagctatcggtattacg
aaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataacgcc
attgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggttta
gaagattatatccgcagcaataccggtctggtgattgacccgtatttctctggcaccaaa
gtgaagtggatcctcgaccatgtggaaggctctcgcgagcgtgcgcgtcgtggtgaattg
ctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccatgtg
accgattacaccaacgcctctcgtaccatgttgttcaacatccataccctggactgggac
gacaaaatgctggaggtgctggatattccgcgtgagatgctgccagaagtgcgtcgttct
tccgaagtatacggtcagactaacattggcggcaaaggcggcacgcgtattccaatctcc
gggatcgccggtgaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaagggatg
gcgaagaatacctacggcactggctgctttatgctgatgaacaccggcgagaaagcggtg
aaatcagaaaacggcctgctgaccaccatcgcctgcggcccgactggcgaagtgaactat
gcgctggaaggtgcagtgtttatggcgggcgcgtccattcagtggctgcgcgatgagatg
aagttgattaacgacgcctacgattccgaatatttcgccaccaaagtgcaaaacaccaat
ggtgtgtatgtggttccggcctttaccgggctgggtgcgccatactgggatccgtatgca
cgcggggcgattttcggtctgactcgtggggtgaacgctaaccacattatacgcgcgacg
ctggagtctattgcttatcagacgcgtgacgtgctggaagcaatgcaggccgactccggt
attcgtctgcacgcgctgcgcgtggacggcggtgcggtggcgaacaatttcctgatgcag
ttccagtccgatattctcggtacgcgcgttgagcgcccggaagtgcgcgaagtcaccgct
ttgggtgcggcctatcttgctggtctggcggttggcttctggcagaatcttgacgagctg
caagagaaagcggtgattgaacgcgagttccgtccaggcatcgaaaccactgagcgtaat
taccgttacgcaggctggaaaaaagcggtcaaacgcgcgatggcatgggaagaacacgac
gagtaa

DBGET integrated database retrieval system