KEGG   Escherichia coli UM146: UM146_20130Help
Entry
UM146_20130       CDS       T02000                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
elu  Escherichia coli UM146
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UM146_20130
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UM146_20130
   00630 Glyoxylate and dicarboxylate metabolism
    UM146_20130
Enzymes [BR:elu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UM146_20130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4204982..4206583
Genome map
AA seq 533 aa AA seqDB search
MTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GMLPDFISETASIRDADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaatcgatgaactggcttttacaaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgtattcagcagcagcaggatatcgataac
ggaatgttgcctgattttatttcggaaacagcttccattcgtgatgctgactggaaaatt
cgcgggattccttcggacttagaagatcgtcgcgtagagattaccggacctgtagagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggcaccagactggaacaaagtgatcgatgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctatagcaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgagacaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagttatatcaaaacattgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaacccttcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcggcgtttattccaagcaaagatgaagag
cgcaataaccaggtgctcgacaaagtaaaagcggataaatcgctggaagccaataacggt
cacgatggcacatggatcgctcacccgggccttgctgatacggcaatggcggtattcaac
gatattctcggctcccgcaaaaaccagcttgaggtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcgtggatctctggcaatggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgactaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
catgggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system