KEGG   Escherichia coli UM146: UM146_22610Help
Entry
UM146_22610       CDS       T02000                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
elu  Escherichia coli UM146
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:elu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:elu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:elu03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:elu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:elu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4726765..4727178
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPPHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccgccacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgaccgatcctctggtgagcgatgttctgcgtgcg
ttaactgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagccgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system