KEGG   Escherichia coli UM146: UM146_22795Help
Entry
UM146_22795       CDS       T02000                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
elu  Escherichia coli UM146
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UM146_22795
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM146_22795
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    UM146_22795
Enzymes [BR:elu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     UM146_22795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4764490..4765776
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQILTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgtttttcccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtacgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatactgacccat
attgcgggcgataagccagtgaccattctgaccgcgacatccggtgatactggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggctaaactctgctaactccattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaatgcg
atggatgttagccagccaaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctggggtatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctatacctcggagccgcacgctgccgtagcttatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcgcataacctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system