KEGG   Escherichia coli UM146: UM146_23155Help
Entry
UM146_23155       CDS       T02000                                 

Definition
isopropylmalate isomerase large subunit (EC:4.2.1.33)
Orthology
K01703  
3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
elu  Escherichia coli UM146
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    UM146_23155
   01230 Biosynthesis of amino acids
    UM146_23155
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    UM146_23155
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    UM146_23155
Enzymes [BR:elu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     UM146_23155
    4.2.1.35  (R)-2-methylmalate dehydratase
     UM146_23155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4842664..4844064)
Genome map
AA seq 466 aa AA seqDB search
MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT
MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP
GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA
KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF
NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV
NDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAE
IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacgttatacgaaaaattattcgacgctcacgtagtgtacgaagccgaaaac
gaaaccccgctgttatatatcgaccgccacctggtgcatgaagtgacctcaccgcaggcg
ttcgatggtctgcgcgcccacggtcgcccggtacgtcagccgggcaaaaccttcgccacc
atggatcacaacgtctctactcagacgaaagacattaatgcctgcggtgaaatggcgcgc
atccagatgcaggagctgatcaaaaactgcaaagaatttggcgtcgagctgtatgacctg
aatcacccgtatcaggggatcgtccacgtaatggggccggaacagggcgtgaccttgccg
gggatgaccattgtctgcggcgactcacataccgccacccacggcgcgtttggcgcactg
gcctttggtatcggcacttccgaagttgaacacgtactggcaacgcaaaccctgaaacag
ggccgggcgaagaccatgaaaattgaagtccagggcaaagccgcgccgggcattaccgca
aaagatatcgtgctggcaattattggtaaaaccggcagcgcaggcggtaccgggcatgtg
gtggaattttgcggcgaagcaatccgtgatttaagcatggaaggtcgtatgaccctgtgc
aatatggcaatcgaaatgggcgcaaaagccggtctggttgcaccggacgaaaccaccttt
aactatgttaaaggccgtctgcatgcgccgaaaggcaaagatttcgacgacgccgttgcc
tactggaaaaccctgcaaaccgacgaaggagcaactttcgataccgttgtcactctgcaa
gcagaagagatttcgccgcaggtcacctggggcaccaatccaggccaggtgatttctgtg
aacgacaatattcccgatccggcttcgtttgccgatccggttgaacgcgcgtcggcagaa
aaagcgctggcctatatggggctgaaaccgggtattccgctgacagaagtggctatcgac
aaagtgtttattggttcctgtactaactcgcgtattgaagatttacgcgcggcagcggaa
atcgccaaaggccggaaagtcgcgccaggcgtacaagcgctggtggttcccggctccggt
ccggttaaagcccaggcggaagcggaaggtctggacaaaatttttatcgaagctggtttt
gaatggcgcttgccaggttgttcaatgtgcctggcgatgaacaacgaccgcctgaatccg
ggcgaacgttgcgcctccaccagcaaccgtaactttgaaggccgccaggggcgcggcggg
cgcacgcatctggtcagtccggcaatggctgccgccgcggctgtgaccggacatttcgcc
gacattcgcaacattaaataa

DBGET integrated database retrieval system