KEGG   Escherichia coli W: ECW_m0298Help
Entry
ECW_m0298         CDS       T02002                                 

Gene name
lys
Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elw  Escherichia coli W
Brite
Enzymes [BR:elw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECW_m0298 (lys)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(318522..319040)
Genome map
AA seq 172 aa AA seqDB search
MMAGIPKKLKAALLAVTIAGGGVGGYQEMTRQSLIHLENIAYMPYRDIAGVLTVCVGHTG
PDIEMRRYSHAECMALLDSDLKPVYAAIDRLVRVPLTPYQKTALATFIFNTGVTAFSKST
LLKKLNAGDYAGARDQMARWVFAAGHKWKGLMNRREVEMAIWNIRGADDLRQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggggataccaaaaaaactgaaagccgcactgctggctgtaacgattgccggt
ggcggagtgggtggttatcaggaaatgacccgtcagtctctgatccacctggaaaatatc
gcttatatgccttaccgcgatattgccggtgtgcttacggtctgtgtgggacataccggg
ccggatatcgaaatgcgccgttacagccatgcggagtgtatggctctcctcgacagtgat
ttaaaaccggtttatgcggcaatcgatcgtcttgtcagggtgccgctgacgccatatcag
aaaacggcgctggcaacgtttattttcaacaccggtgttaccgcattcagtaaatcaacg
ctgctgaaaaaactcaatgccggtgattacgccggagcgcgtgaccagatggcccgctgg
gtgtttgccgcaggccataaatggaaaggactgatgaaccgtcgcgaagtggaaatggca
atctggaatatcaggggggcggatgaccttcgccagtaa

DBGET integrated database retrieval system