KEGG   Escherichia coli W: ECW_m1527Help
Entry
ECW_m1527         CDS       T02002                                 

Gene name
paaA
Definition
(RefSeq) enoyl-CoA hydratase-isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
elw  Escherichia coli W
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:elw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ECW_m1527 (paaA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECW_m1527 (paaA)
   00650 Butanoate metabolism
    ECW_m1527 (paaA)
  Lipid metabolism
   00071 Fatty acid degradation
    ECW_m1527 (paaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECW_m1527 (paaA)
   00310 Lysine degradation
    ECW_m1527 (paaA)
   00360 Phenylalanine metabolism
    ECW_m1527 (paaA)
   00380 Tryptophan metabolism
    ECW_m1527 (paaA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECW_m1527 (paaA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECW_m1527 (paaA)
   00281 Geraniol degradation
    ECW_m1527 (paaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECW_m1527 (paaA)
   00627 Aminobenzoate degradation
    ECW_m1527 (paaA)
   00930 Caprolactam degradation
    ECW_m1527 (paaA)
Enzymes [BR:elw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECW_m1527 (paaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1572246..1573013
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system