KEGG   Escherichia coli W: ECW_m1527Help
Entry
ECW_m1527         CDS       T02002                                 

Gene name
paaA
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
elw  Escherichia coli W
Pathway
elw00071  Fatty acid degradation
elw00280  Valine, leucine and isoleucine degradation
elw00281  Geraniol degradation
elw00310  Lysine degradation
elw00360  Phenylalanine metabolism
elw00362  Benzoate degradation
elw00380  Tryptophan metabolism
elw00410  beta-Alanine metabolism
elw00627  Aminobenzoate degradation
elw00640  Propanoate metabolism
elw00650  Butanoate metabolism
elw00903  Limonene and pinene degradation
elw00930  Caprolactam degradation
elw01100  Metabolic pathways
elw01110  Biosynthesis of secondary metabolites
elw01120  Microbial metabolism in diverse environments
elw01130  Biosynthesis of antibiotics
elw01212  Fatty acid metabolism
Module
elw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:elw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECW_m1527 (paaA)
   00650 Butanoate metabolism
    ECW_m1527 (paaA)
  Lipid metabolism
   00071 Fatty acid degradation
    ECW_m1527 (paaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECW_m1527 (paaA)
   00310 Lysine degradation
    ECW_m1527 (paaA)
   00360 Phenylalanine metabolism
    ECW_m1527 (paaA)
   00380 Tryptophan metabolism
    ECW_m1527 (paaA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECW_m1527 (paaA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECW_m1527 (paaA)
   00281 Geraniol degradation
    ECW_m1527 (paaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECW_m1527 (paaA)
   00627 Aminobenzoate degradation
    ECW_m1527 (paaA)
   00930 Caprolactam degradation
    ECW_m1527 (paaA)
Enzymes [BR:elw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECW_m1527 (paaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADT75005
UniProt: E0IVR3
Structure
PDB: 

Jmol
Position
1572246..1573013
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system