KEGG   Escherichia coli W: ECW_m2621Help
Entry
ECW_m2621         CDS       T02002                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
elw  Escherichia coli W
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECW_m2621 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECW_m2621 (glk)
   00052 Galactose metabolism
    ECW_m2621 (glk)
   00500 Starch and sucrose metabolism
    ECW_m2621 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECW_m2621 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECW_m2621 (glk)
   00524 Butirosin and neomycin biosynthesis
    ECW_m2621 (glk)
Enzymes [BR:elw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECW_m2621 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2692918..2693883)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HNNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggtcctgggctggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcattaacgctgggaacctttggtggggtttatatt
gctggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
cataacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system