KEGG   Escherichia coli W: ECW_m2915Help
Entry
ECW_m2915         CDS       T02002                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
elw  Escherichia coli W
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2989543..2990967
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGTYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDELAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaagggctgaccacggtcgatatgatcccgcacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgcctcttcccgcag
ggcgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccagaacctgctttgaagcatttgatggtctggtgaaatactggctcaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagctgcaagccggaggatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcgatgtgcaggcgcggggcacgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgagatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaacagcagtgcggcgaacgtggtgaaatcgctgcgtaacccatatctacag
gtaagcgactggggctggggtattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgttatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
cttgctgccaatggcgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggttttgtcttt
gttgaccgtgacgacgcaggcaacggcacgctgacgcgcacgcgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtaa

DBGET integrated database retrieval system