KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0117Help
Entry
CDCO157_0117      CDS       T02122                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00010  Glycolysis / Gluconeogenesis
elx00020  Citrate cycle (TCA cycle)
elx00620  Pyruvate metabolism
elx01100  Metabolic pathways
elx01110  Biosynthesis of secondary metabolites
elx01120  Microbial metabolism in diverse environments
elx01130  Biosynthesis of antibiotics
elx01200  Carbon metabolism
Module
elx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCO157_0117 (aceF)
   00020 Citrate cycle (TCA cycle)
    CDCO157_0117 (aceF)
   00620 Pyruvate metabolism
    CDCO157_0117 (aceF)
Enzymes [BR:elx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CDCO157_0117 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFJ27167
UniProt: A0A0F6BYW1
Structure
PDB: 

Jmol
Position
130184..132076
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAVPEAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcttctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaactcagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagtcccc
gaggctgccgcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgacaaagttgaagctgagcagtcgctgatcaccgta
gaaggcgataaagcttctatggaagttccggctccgtttgcaggcaccgtgaaagaaatc
aaagtgaacaccggcgacaaagtgtctaccggctcgctgattatggtcttcgaagtggcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcggctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgattacc
gtagaaggcgataaagcttctatggaagttccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcagcagcgccggctccggca
gcaaaagctgaagccccggcagcagcaccggctgcgaaagcggaaggcaaatctgaattt
gctgaaaatgacgcttacgttcacgcgaccccgctgatccgccgtctggcacgcgagttt
ggcgttaaccttgcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagac
gttcaggcttacgtgaaagaagctatcaaacgtgcagaagcagctccggcagcgactggc
ggtggtatccctggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgg
gtgatgatcccgcatgttactcacttcgacaaaaccgatatcaccgagctggaagcgttc
cgtaaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggtt
gtcttcatcatgaaagccgttgctgcagcgcttgagcagatgcctcgcttcaacagttcg
ctgtcggaagacggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtg
gataccccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatc
gaactgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcg
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatg
gagccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctcc
ttcgaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system