KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0780Help
Entry
CDCO157_0780      CDS       T02122                                 

Definition
(GenBank) putative pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00040  Pentose and glucuronate interconversions
elx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDCO157_0780
Enzymes [BR:elx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CDCO157_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: AFJ27827
UniProt: A0A0F6C0S1
Structure
PDB: 

Jmol
Position
complement(890788..892071)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWGDAVISNRPFAGNTGSVDDSDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccacccgatcaacgtccttctgatcaaactgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgctgcagcgtggaatccgtccccgataaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgcaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatgtccctgctgctccaggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatgggggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctgtgttctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggt
gatagcgtagatgcgggtaaccatccggcggtggcactgcgtactgacggtgaccaggta
cagattaacaacgttaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccgcgtacgctggtgaccaacagctacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcacaactgggccgctcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacggctaaaccgtggggcgatgcggtgatctct
aatcgtccgtttgcgggtaacaccggcagcgttgacgatagcgacgaaatacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagcaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system