KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_1420Help
Entry
CDCO157_1420      CDS       T02122                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:elx00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:elx00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525145..1526170
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPEKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSTLIRENKLDAIMPAHVIYSDVDPRPASGSSYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQVSLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgaaactatcatgatcctgcc
cagttgcgtgaactggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcg
gtagatcaggaaggtggacgcgtccagcgttttcgcgaaggttttacccgcttaccggca
gcacaatcctttgctgcgctgttgggaatggaagagggcggcaaactggcgcaagaggcg
ggttggctgatggccagcgaaatgatcgctatggatattgatatcagctttgcgccagtg
ctggatgtaggacatatcagcgcggcgattggcgagcgttcttatcatgccgacccagaa
aaagccctggcaatcgccagtcggtttattgatgggatgcatgaagccggaatgaaaacg
accgggaaacacttcccaggacacggtgcagtaactgcagattcacacaaagagacgccg
tgcgacccacgcccgcaagcggaaattcgtgccaaagatatgtcggttttcagcacgtta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttcttcctactggctgaaaaccgttttgcgtcaggaactgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggtgccgcgattatgggcagt
tatgccgaacgcgggcaggtatcactggatgcgggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcgcccgtctgaatcagttacatgaacgctggcaggaagagaaagcaggt
cactaa

DBGET integrated database retrieval system