KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_1753Help
Entry
CDCO157_1753      CDS       T02122                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00260  Glycine, serine and threonine metabolism
elx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elx01100  Metabolic pathways
elx01110  Biosynthesis of secondary metabolites
elx01130  Biosynthesis of antibiotics
elx01230  Biosynthesis of amino acids
Module
elx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDCO157_1753
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDCO157_1753
Enzymes [BR:elx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDCO157_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ28810
UniProt: A0A0F6C3K4
Structure
PDB: 

Jmol
Position
complement(1820181..1821374)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacggctggcacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggggccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggggccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgtttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagtttcagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgcagatttcatcaacgaaaccaacgtcggcctgattggtgtggagcctggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggtatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactcgattttccgtccgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattatgtgtcaattaccgatgatgaagcactggaagccttcaaaacgctgtgc
ctgcacgaagggattatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system