KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2323Help
Entry
CDCO157_2323      CDS       T02122                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCO157_2323
Enzymes [BR:elx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDCO157_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2416281..2417165
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDANGVALTFE
LTQSEETKKFWLHDFTLLAHFRVDKNCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASEMQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtagtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcaggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgttgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggcctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctaatggcgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggctgcacgactttactctgttagcgcat
ttccgcgtggataaaaactgtgaaatcgatcttgaagcacacggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccgggaccggcgctttcagttagcatgggcgacatgccggacgatggctac
aagacctttgtttgtgtagaaacagcttacgcctcagaaatgcaaaaagtgaccaaagaa
aaacctgcacatctggcgcaatccattcgcgttgccaaacgttaa

DBGET integrated database retrieval system