KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2529Help
Entry
CDCO157_2529      CDS       T02122                                 

Definition
putative endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Brite
Enzymes [BR:elx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CDCO157_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2621781..2622314)
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDQVNAIERDKALEWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgcaggg
gcgtctgcgcctgaaatcctcgaccagtttcttgacgaaaaagaaggtaaccacaccacg
gcataccgtgatggtgcgggtatctggaccatctgccgcggtgccatcctggtggatggt
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccaggttaacgccatt
gaacgtgataaggcgctggagtgggtggagcgcaatattaaagtaccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgcaggtgatcgcaggggagcgtgtgaggcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgctcaaacaactgctacggtcag
gtttcacggcgtgaccaggagagcgcgctggcgtgctggggaattgacagataa

DBGET integrated database retrieval system