KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_4489Help
Entry
CDCO157_4489      CDS       T02122                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:elx00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:elx00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:elx00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:elx00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4727924..4728793
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacccaaaccagcgatctgaacaaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggggttatgctaaacgatttgttttga

DBGET integrated database retrieval system