KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_5016Help
Entry
CDCO157_5016      CDS       T02122                                 

Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00230  Purine metabolism
elx00240  Pyrimidine metabolism
elx01100  Metabolic pathways
elx03030  DNA replication
elx03430  Mismatch repair
elx03440  Homologous recombination
Module
elx_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CDCO157_5016
   00240 Pyrimidine metabolism
    CDCO157_5016
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CDCO157_5016
   03430 Mismatch repair
    CDCO157_5016
   03440 Homologous recombination
    CDCO157_5016
Enzymes [BR:elx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDCO157_5016
DNA replication proteins [BR:elx03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDCO157_5016
DNA repair and recombination proteins [BR:elx03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     CDCO157_5016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: AFJ32061
UniProt: A0A0F6CCV5
Structure
PDB: 

Jmol
Position
5353621..5354034
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system