KEGG   Elusimicrobium minutum: Emin_0085Help
Entry
Emin_0085         CDS       T00741                                 

Definition
putative Beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
emi  Elusimicrobium minutum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:emi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:emi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
90391..92016
Genome map
AA seq 541 aa AA seqDB search
MKKLFFVVFFTAVFAHGAVPDFDSLTLDQKLGQTLVAFVDTDNAHKYQSAIEKGLVGGVL
VQWGNYSLEQTTELAAKLQSWAAKSPHKIPLLISIDYEGGTVYTPVTLGFEYLPPNMMIA
AANDEEAAARIFYLAGLELRKAGIHINFSPVVDVNINPGNPIIGVRSFGSSPELVGRMGA
AVVSGLSAANVMSVAKHFPGHGNTVLDSHYSLPVLNITKKEMQDVHLAPFKKAIEAGVPG
IMTAHIIYKNYDPKNPATYSKRILNDLLRTEMKFKGVIISDALDMKGATLDGNIALSAAK
TLEAGSDMALLGRFLNADKTFNKIYGYVGTELSQKRIEEASKKILDLKKQMGLFDEQKEP
FTSTSKAYAAAAEVIAKKSVTVLRNKNNKIPLKEEFANTPGKKVCAVFFAPTRFAEEITS
FNKPFLEKGWKVNYYNAIMKPTSKDLKRARECAKGADLFVIGTLQWAAKPFYKQTAVIGT
LLEEFPDAVVISTMSPYEVKTYPGAKTVLLTYGISKHSMKAAADVIVGNIPAQGKLPIEL
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactattttttgttgtattttttacggctgtttttgcccacggggctgtgcct
gattttgattcccttacattggaccagaaattgggacagacgcttgttgcttttgtcgat
acggacaatgctcataaataccaaagtgctatagaaaaagggttggttggcggtgtgctt
gtgcaatggggcaactactctttagagcaaacgaccgagcttgcggccaaattacaaagc
tgggcggccaaatccccgcataaaatacctttattaatttcaatagattatgaaggcggc
acggtttatactccggttactttaggttttgaatatcttccgccaaacatgatgatagcc
gccgctaatgatgaggaagcagcggccagaatattttatcttgccggccttgaacttaga
aaagcgggtatacatataaacttttcgcccgtggttgacgttaacattaatccgggcaac
cctataataggggtacgctctttcggctcctcgccggaattagtgggacgtatgggcgcg
gctgttgtaagtgggcttagcgcggcgaacgtaatgtccgtggcgaaacattttcccggc
cacggcaacactgttttggattctcattacagccttcctgttttaaacataacaaaaaaa
gaaatgcaggatgttcatctggctccatttaaaaaagcaatagaagcaggtgtgccgggt
ataatgacggctcatattatttataaaaattatgaccccaaaaatcccgccacatattcc
aaaaggatattaaatgatttattgcgtacggagatgaaatttaaaggcgtaattatatca
gacgcgcttgatatgaaaggcgctaccttagacggcaacatcgctttaagcgcggctaag
acgcttgaggcgggttccgatatggcgcttttgggcaggtttttaaacgcggataaaact
tttaataaaatttacggttatgtgggaacggaactttcacaaaaaagaattgaagaagct
tctaaaaaaatacttgatttaaaaaaacaaatgggtttgtttgacgaacagaaagaacct
tttacctccacttccaaagcttacgccgccgcggcggaagttatagccaaaaaatcagta
accgttttaagaaataaaaataataaaattccgttaaaagaagagtttgctaacactccg
ggtaaaaaagtgtgcgccgtgttttttgcccctacaagattcgcggaggaaataacttcg
tttaacaaaccgtttttggaaaagggatggaaggtaaattattataacgctattatgaaa
cccacaagcaaagatttaaaacgcgcaagagaatgcgctaaaggagcggacctttttgtt
ataggaactttacagtgggcggcaaaacctttttacaaacaaacagccgtaataggcact
ttgcttgaagaatttcccgacgcggttgttatatcaacaatgagcccgtacgaagtaaaa
acttaccccggcgctaaaactgttttattaacttacggcataagcaagcattcaatgaag
gcggcggcggacgtgattgtgggcaatatccccgcgcagggtaagctgcccatagaattg
gaataa

DBGET integrated database retrieval system