KEGG   Elusimicrobium minutum: Emin_0151Help
Entry
Emin_0151         CDS       T00741                                 

Definition
(GenBank) Glycolysis
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
emi  Elusimicrobium minutum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emin_0151
   01230 Biosynthesis of amino acids
    Emin_0151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emin_0151
   00051 Fructose and mannose metabolism
    Emin_0151
   00562 Inositol phosphate metabolism
    Emin_0151
Enzymes [BR:emi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Emin_0151
Exosome [BR:emi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Emin_0151
  Exosomal proteins of bladder cancer cells
   Emin_0151
  Exosomal proteins of melanoma cells
   Emin_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
159384..160142
Genome map
AA seq 252 aa AA seqDB search
MTKRIPFISGNWKMHNTIAESKALAKAIADCKENKNNADIMIAPSYTSLAAVAEAVKGSK
VAVAAQDVHFEEKGAFTSAVAPSQIKDAGASHVIIGHSERRSLFGDTDAILNKKVAAALK
HGLTVVFCVGETLAEREADKTLGVIESQLENGLKGFTAEQLSSMVVAYEPVWAIGTGKTA
TPEQAQEVHASTRKYLSSKYGEDFASKVRIVYGGSVKTDNVDAIMAQPDVDGALVGGQSL
VAEQFIRIINFN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagaataccttttatttcaggcaactggaaaatgcacaatactattgcggag
tcaaaagctttggcaaaagctattgctgattgcaaagaaaacaaaaacaacgctgatatt
atgatagccccttcttatacgagcttagcggccgtggcggaagcggttaaaggttccaaa
gtggcggtagccgcccaggacgtgcattttgaagaaaaaggcgcttttacaagcgcggta
gccccttcacagattaaagacgcgggcgcttcccacgttattataggacacagcgaaaga
cgcagcttatttggcgatacggacgcaattttaaataaaaaagtagccgccgcgcttaaa
cacggcttaacggttgttttttgcgtaggagaaacgcttgccgaaagagaagcagataaa
actttaggcgttattgaatcacagcttgaaaacggcttgaaaggttttacggctgaacag
ctttcctcaatggttgtagcttatgaacctgtttgggcaatcggcaccggcaaaacagcc
acgccagaacaagctcaggaagtgcacgcttcaacaagaaaatatttaagctctaaatac
ggtgaggattttgcctcaaaagtaagaatagtttacggcggcagcgtgaagacggataat
gttgacgcaattatggcccagccagatgttgacggcgccttagtaggcgggcagtcatta
gtggcggagcagtttataaggattattaactttaactaa

DBGET integrated database retrieval system