KEGG   Elusimicrobium minutum: Emin_0160Help
Entry
Emin_0160         CDS       T00741                                 

Definition
repressor, OrF, Kinase protein family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
emi  Elusimicrobium minutum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emin_0160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emin_0160
   00052 Galactose metabolism
    Emin_0160
   00500 Starch and sucrose metabolism
    Emin_0160
   00520 Amino sugar and nucleotide sugar metabolism
    Emin_0160
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Emin_0160
   00524 Butirosin and neomycin biosynthesis
    Emin_0160
Enzymes [BR:emi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Emin_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
171483..172451
Genome map
AA seq 322 aa AA seqDB search
MIGIGIDVGGTFVKFFALNEQGKEIKYHKLETDMSKGPAFFIKQIADFINVWKKEFKEEI
CIGLGLPGDVDNKKGVLRFGTNLKFKNKNIKKIEFGAGIKKLTGIEPVTANDATIAAWGI
YELILKKKYANVLVITMGTGIGGGVIVNGNLYQGSHGSAGEIGHIKISLDPKAPLCGCGA
RGCLEAYAGTIAIHRLVNEEVKKHPSSLLAKMAAKDKKFKIALVSEAAAKGCNSAKRVWE
KVGLSIGAGIANAGLILDFDVVVLAGGVSGAAKYFMPALKKRLSLEKIITPFKNLKIYTS
QLPEIGGIGAALYAINRNKNAN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgataggaataggcattgatgtcggcggaacttttgtaaaatttttcgcgttaaacgaa
caaggaaaagaaattaaatatcataaacttgaaacggacatgagtaaaggcccggctttt
tttattaagcaaatagcggattttattaatgtttggaaaaaggaatttaaagaagaaatt
tgcataggccttggccttccgggcgacgttgataataaaaaaggcgttttaagattcggc
acaaatttaaaatttaaaaataaaaacataaaaaaaattgagtttggcgcgggtattaaa
aaacttacggggattgaacctgttaccgctaacgacgccactattgccgcttggggcatt
tatgagcttattttaaaaaagaaatatgctaacgtgctggttataaccatgggtacgggg
ataggcggcggcgttattgttaacggcaatttgtaccagggctcgcatgggtccgcgggc
gaaatagggcatataaaaatttctttagatccgaaagcgcccttatgcggatgcggcgcc
agaggttgccttgaggcttacgctggcacaattgccatacacaggctggtaaatgaggaa
gtaaaaaaacatccttcaagcttactcgctaaaatggcggctaaagataaaaaatttaaa
atagccttggtatccgaagcagccgcgaaaggctgtaatagcgcaaaaagagtttgggaa
aaagtaggtttaagtataggcgcgggcatagcaaacgcggggcttatacttgattttgac
gtagtggtcttagcaggcggagtttcgggtgcggcaaaatattttatgcccgccttaaag
aaaaggttgtctttggaaaaaattattaccccttttaaaaatttaaaaatatatacctcc
cagttgcctgagataggcggcataggcgcggctttatatgcaataaacagaaataagaat
gcgaactag

DBGET integrated database retrieval system