KEGG   Elusimicrobium minutum: Emin_0226Help
Entry
Emin_0226         CDS       T00741                                 

Definition
restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
emi  Elusimicrobium minutum
Brite
Enzymes [BR:emi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Emin_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
243002..245665
Genome map
AA seq 887 aa AA seqDB search
MKLHFDAKQPYQQDAMRAIIDVFKGQPINNGDFEASFGGVDGLALSIMGVKNNIVLSEEQ
ILKNVCEVQEKNGLDIATKLEGLNFTIEMETGTGKTYVYLRTIYELNKQYGFKKFVIVVP
SIAIKEGVLKNLEITHEHFQGLYENTSVKFQVYDSAKVSALRGFADSNNIEILVINIDSF
AKDENVVNNENDKLTGKKPIEFIQATNPIVIVDEPQNMETEIRKRAIARLNPACTLRYSA
THKNMYNLLYSLDPVKAYDLGLVKQIEVDSVITENDHNRAFIELVEFKQNKNSVLAKVKI
ECESPSGVKSKVVTIGADEKYDLYQLSGQREIYKDNFVPISLDAGEGFVEFGNGLRVSLG
QSNSQVKDDIMKTQIERTIAEHLAKEKQLRPQGIKVLSLFFIDRVANYRAWDESGNIVEG
KIHKWFEEIYKNIVSKSGNSNIMSQDIKEIHNGYFSQDKKGHLKDSSESRETKDDADTYQ
LIMKDKERLLDVNNPLRFIFSHSALREGWDNPNVFQICTLNETRSEMKKRQEIGRGLRLA
VNADGMRIYDKSINKLTVVANETYADFSANLQKEIEDDCGVAFQGRIKDKRARKKVGLKK
GFELDAKFIELWDKIKHKTTYKVDYDSQDLIKAAGKALRDLETEIKAPIIRTVKTGVNIT
SEGVFGTVKGSTTKAMAAGFEIPNIIDYIQSRLSSKLTRKTILEIIKASGRMEDVLKNPQ
MFLDLAIGKINNVMNELMVDGIKYEKIAGQEWQMLLFKEQEIESYIENLYPIKNQDKTIA
DSIVIDSLSSPERQFAEDCENNDNVDFFIKLPDWFKIRTPMGTYNPDWALIYKNDKRIYF
VAETKSTLSLDRLRTEEQLKIKCGKAHFKDFKDVEFKHVTKVGDLIS
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacattttgatgctaagcagccgtaccagcaagacgctatgcgggctataata
gacgtgtttaaagggcaacctataaataatggggactttgaagcgtcttttggtggcgtg
gatgggctggcactatctataatgggtgttaagaataatattgtactttcagaagaacaa
attttaaaaaatgtgtgtgaagtgcaagaaaaaaatggcctagatattgccactaaactg
gaagggctaaacttcaccatagaaatggaaacaggtacaggtaaaacctatgtttacctt
agaaccatttatgagctgaacaaacagtacggctttaaaaaatttgtgattgtggtgccc
agcatagccataaaagaaggtgtgttaaaaaacctggaaattacgcatgagcacttccaa
ggtttgtatgaaaacacttcagtaaaatttcaggtttacgactctgctaaagtatctgcc
ctgcgtgggtttgctgatagtaataacattgaaatacttgttataaacatagactcattt
gccaaggatgaaaacgttgtaaataatgaaaacgataaactgactggcaaaaaaccaata
gagtttattcaggctactaaccccatagttattgtggacgaaccgcaaaatatggaaact
gaaatacgtaagcgtgccatagcaagacttaaccctgcttgcacgttaagatactccgcc
acgcataaaaacatgtataacctgctttatagtttggaccctgttaaagcctatgaccta
gggcttgttaaacagatagaagtggatagcgtgataacagaaaacgaccataacagggca
tttattgaactggtggaatttaaacaaaataaaaacagtgtgttggctaaagttaagatt
gagtgtgagagcccctctggcgttaagtcaaaggtggtaaccataggcgcagatgaaaag
tatgacctctaccaactttctggacagcgtgaaatatacaaagataattttgtgccaata
tctttagacgctggggaaggctttgtggagtttggcaatggcttaagagtatctctggga
caaagcaacagccaagtgaaagatgacataatgaaaacgcagatagagcgcaccatagcc
gaacatttagccaaagaaaaacaactgcgcccacaaggcattaaagtattgtctttgttt
tttattgatagagtggcaaactatagggcctgggatgaaagtggaaacattgtggaaggc
aaaatacacaaatggtttgaagaaatttataaaaatattgtcagtaaatctggcaatagc
aacattatgagccaggatataaaagagatacataatggctatttctcccaagataaaaag
ggacacctgaaagactcctcagagagcagggaaacaaaagacgatgctgatacataccag
cttattatgaaagataaggaacgcttgctggatgttaataatcccctgcgctttatattt
agccactctgcccttagggaaggctgggacaaccctaatgtgtttcagatatgcacgtta
aatgaaaccaggtctgaaatgaaaaagaggcaagaaataggccgtggattacgccttgct
gttaatgcagatggtatgcgaatttatgacaaaagtataaataaactaacagttgtagct
aacgaaacttatgccgatttttccgcaaacttacaaaaagaaatagaagatgattgcggt
gtggccttccagggtaggattaaagataaaagagcaagaaagaaggtgggccttaagaaa
ggatttgaactggatgctaaatttattgaactctgggacaagattaaacacaaaactacg
tataaggtggactatgactcccaggaccttataaaagccgcaggaaaggccttgagggac
ctggaaacagagataaaagcccctatcatcagaactgttaaaactggcgtcaatataact
agcgaaggcgtatttgggaccgttaaaggcagcacaacaaaggctatggcagctggtttt
gagatacctaatatcattgactatatacaaagcaggcttagctccaaattaacccgtaaa
actatattggaaattatcaaggcctctggcaggatggaggatgtattaaagaacccacaa
atgtttttagacctagctataggcaaaataaacaatgtaatgaatgagcttatggtagac
ggcattaaatatgaaaagatagcagggcaagaatggcagatgcttttgtttaaggaacag
gagatagagtcttatattgaaaacctgtaccctatcaagaaccaggataagacaatagcg
gatagcattgttattgattccttatccagccccgagcgtcagtttgccgaagattgcgag
aataatgataacgtggacttttttataaaactacccgactggtttaaaataagaacgcca
atgggcacttataatccagactgggcgttaatctacaaaaatgataagaggatatacttt
gtagcagaaacaaaatctaccctatcactggatagattgcgaacggaagagcagttaaaa
ataaagtgtggtaaggcacattttaaagactttaaagatgttgaatttaagcacgttacg
aaagtgggtgatttaatttcttaa

DBGET integrated database retrieval system