KEGG   Elusimicrobium minutum: Emin_0234Help
Entry
Emin_0234         CDS       T00741                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
emi  Elusimicrobium minutum
Pathway
emi00300  Lysine biosynthesis
emi01100  Metabolic pathways
emi01120  Microbial metabolism in diverse environments
emi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Emin_0234
Enzymes [BR:emi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Emin_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACC97796
UniProt: B2KB37
Position
253472..254707
Genome map
AA seq 411 aa AA seqDB search
MSIKEILKKIDGSKQFVIDMQKGLTAIPALSPTLPGGEGEYDKAVYLESVLKKMKFDEVY
RLDCPDKKAKNGVRPNIIAKYYGKDKTKNFWVMAHMDIVSPGDLSLWKTDPYKAEVKGDL
IYGRGTEDNQQGLISGLVAVKAMMDLGIRPDINFSFIFNADEETGSAYGIGHIVKKHFKI
FGKNDCVMVPDGGNKEGTQVEVAEKSICWLKFKVFGKQFHASMPESGNNAHRAGANLIVA
LDEALHKKFNKKDKMFAPSVSTFEPTKKESNVDSINILPGEDVFYFDCRILPVYKVEQVM
KEVNAVVKKISQKFKTKITVEVVQNESSIPTNPKAEIVKATVNAVKLVYKNNPKVVGIGG
GTVSAFLRNKGVPCVVYSKLLETLHSPNECSSIKNTLGDAKVFAHMAMTLK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaggaaattttaaaaaaaattgacggttcaaaacaatttgttatcgatatg
caaaaaggtttaactgctataccggcgctttcacccacgttgcccggtggcgaaggggaa
tatgataaagcggtttatttggaaagtgttttgaagaaaatgaaatttgacgaagtttac
cgtttggactgcccggacaaaaaagctaaaaacggcgtaagacccaacattatagccaag
tattacggcaaagataaaacaaaaaacttttgggttatggcgcacatggacattgtgtcc
cccggcgatttaagcctttggaaaacggacccttataaagcggaagtaaagggggattta
atttacggccgcggaactgaagataaccagcaaggtcttatctcaggtttggtagccgtt
aaagctatgatggaccttggcataaggcccgatattaattttagttttatttttaacgct
gacgaagaaacaggcagcgcgtacggtataggacatatcgtaaaaaagcattttaaaatt
ttcggtaaaaatgactgtgttatggtgccggacggcggcaacaaggaaggcactcaggtt
gaagtggctgaaaaatctatttgctggcttaaatttaaggtgttcggcaagcagttccac
gcctcaatgccggaaagcggaaataatgcccatagagcgggtgctaacttaatagtagcg
cttgatgaagctttgcataaaaaatttaataagaaagacaaaatgttcgcgccttcggta
agcacgtttgagcctacaaaaaaggagtcaaatgttgacagcattaacattttgcccggt
gaggacgttttttattttgactgccgtatcctgcctgtttataaagttgaacaggttatg
aaagaggttaacgccgtagttaaaaaaatcagccagaaatttaaaacaaaaattaccgtt
gaggtagttcaaaatgaaagctctatacccactaaccctaaggctgaaattgttaaagcc
actgtaaatgccgttaaacttgtttataaaaacaaccccaaagttgtaggtataggcggg
ggcacagtgtccgcgtttttaagaaacaaaggcgttccttgtgttgtatactcgaagctg
cttgaaacgctgcacagcccgaatgaatgttcaagtattaagaatactttgggcgacgct
aaagtattcgctcatatggcaatgactttaaaatag

DBGET integrated database retrieval system