KEGG   Elusimicrobium minutum: Emin_0287Help
Entry
Emin_0287         CDS       T00741                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
emi  Elusimicrobium minutum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emin_0287 (gpmA)
   01230 Biosynthesis of amino acids
    Emin_0287 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emin_0287 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Emin_0287 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emin_0287 (gpmA)
Enzymes [BR:emi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Emin_0287 (gpmA)
Exosome [BR:emi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Emin_0287 (gpmA)
  Exosomal proteins of melanoma cells
   Emin_0287 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(306512..307258)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLLRHGESTWNKENRFTGWTDVDLTEKGVAEAAKAGEILKKEGFIFDKAYTSYLKR
AVKTLNCVLDKMDLDWINVEKTWRLNEKHYGTLQGLNKAETAEKYGAEQVQLWRRSFDIA
PDPIPEDDPRNPRKDIRYKNVTNADLPATESLKDTIARTMPYWTDVIMKQLKTSNQLIVV
AHGNSLRGVIKHLKNISDEDIVNLNLPTAVPYVFEFDDNLNMTRDYFLGDPEEVKKLMEA
VANQAKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgtacttttaagacatggcgagagcacctggaacaaagaaaaccgcttc
acaggctggactgacgttgatttaacggaaaaaggtgtggctgaagccgccaaagccggc
gaaatcttaaaaaaagagggctttatttttgataaagcatatacttcttatttaaaacgc
gcggtaaaaacgcttaactgtgtgcttgacaaaatggacttggattggataaacgttgaa
aaaacatggcgtcttaatgaaaaacactacggcacccttcaaggtttaaacaaagccgaa
acagccgaaaaatacggagccgaacaggttcaattatggcgtagaagttttgatatcgcg
cccgatccgatacccgaagacgacccgagaaacccgcgtaaagacatacgttataaaaac
gtaacgaacgcggatttgcccgctaccgaatcactaaaagacactatagcccgcactatg
ccttattggacggatgttataatgaagcagttaaaaacatcaaaccagcttattgttgtt
gcccacggcaacagtttaagaggcgtaataaaacatttaaaaaatatttcggacgaagat
attgtaaacttaaatttacctacagcggtaccttatgttttcgagtttgacgataatctt
aatatgacaagagattattttttgggcgatcctgaggaagtaaaaaaacttatggaagcc
gtggccaaccaggctaaaaagaaataa

DBGET integrated database retrieval system