KEGG   Elusimicrobium minutum: Emin_0354Help
Entry
Emin_0354         CDS       T00741                                 

Definition
(GenBank) Peptidase M42 family protein
Organism
emi  Elusimicrobium minutum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
379437..380477
Genome map
AA seq 346 aa AA seqDB search
MDIELFRKIAELPGISGREEAVRAALLKMLKTCTDEQRVDAMGNIIAVKKGKGVRKLMLA
AHMDEIGLLVSHIENNGFLRFVPVGGIDARTLMSQRVVIHTSKGPIFGVIGTKPVHLLDA
AEASKAPGIKSLFIDTGLDGSEINSIVSIGDPVTLDRTTVEFGSQMINSKAIDDRAGVYV
FIEALKKVKKFDCDIYAVFSVQEEVGLRGAVTSTFGVDPDLALVVDATAANDLPATPPQE
FNCRLGQGVAITIMDGGSIINPQIVKTLKKLASDKNIKHQFKVSARGSNDAAAVQKTKSG
VPVGLLSIPTRYIHSSIETASKIDIDAAVDLTVAFIENACKYNFDY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaattatttagaaaaatagccgaattgccgggtatatccggcagggaagaa
gcagttagagccgcccttcttaaaatgcttaaaacatgtaccgatgagcagcgtgttgac
gctatgggcaatattattgccgttaaaaagggtaaaggcgtaagaaagcttatgcttgcc
gcccatatggacgagataggccttcttgtaagccatattgaaaataacggttttttacgt
tttgttcccgtaggcggtattgacgcaagaacgcttatgagccagcgtgttgtaatacac
acatcaaaagggccgatattcggcgttataggaacaaaaccggtacatttgcttgacgcc
gctgaagcttcaaaagcgcctggtattaaaagtttatttattgataccggtttggacgga
tctgaaataaattcaattgtaagcataggcgaccctgttactttagacagaactactgtt
gaattcggatctcaaatgattaactccaaagctattgatgacagagcaggcgtttacgtt
tttattgaagctttaaagaaagttaaaaaatttgactgtgatatttacgccgttttcagc
gtgcaggaagaagttggtttaagaggagcagtaacttcaaccttcggggtggacccggat
ttggcgcttgttgttgacgctaccgccgctaatgatttgcccgccactcccccgcaggaa
tttaactgccgtttagggcaaggcgtagccataacaattatggacggcggctccattatc
aatccgcaaatagttaaaactttaaaaaagctggcttcggataaaaacattaaacaccag
tttaaagtttcggcccgcggttctaacgacgctgctgccgtgcaaaaaacaaaaagcggc
gttcccgtagggctgctttcaatacctacgcgttatatacattcaagcatagaaacggct
tcaaaaattgatatagacgcggcggttgatttaacagtggcttttatagagaacgcctgt
aaatataattttgattactaa

DBGET integrated database retrieval system