KEGG   Elusimicrobium minutum: Emin_0386Help
Entry
Emin_0386         CDS       T00741                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
emi  Elusimicrobium minutum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:emi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(412660..414216)
Genome map
AA seq 518 aa AA seqDB search
MEPVLNKRSVGIVMPLFAMRSVADWGVGDFASMKNWINYLASTKTSVLQILPINEMAPQH
SCPYNAMTSFAIDPVYICVEEVQDIINSPEAQSFIKTIRPVVDIWQKSERVHYVTIRDAK
LKALWNGFGYFLTNEWLKDSDRAKEFKTFLAQHAHWLDNYALFRALKDYFKWQSWTLWPE
EFQNADKNALAGFEKDYFKQVLFFKYLQWIAEEQIKQVTSLAASKQMYIFGDIPFGINLD
SADVWAERDNFNTAVEVGAPPDQFSTEGQHWGMPGYNWLHMQATGYEYWKRKVGRACELF
DIFRLDHFVGFFRTYIYKSQEDRGEFDWLGEDAQAKRGYDFLVAIQEASRGKQSVGEDLG
VIPDYVRRIMADLNIPGYKIMRWEQDSGYYRDPAKYPYISIAAVSTHDTETLKGWWESIP
LADRADVWEMISGVKTDGIIPFTQEIQEQILRRLMNSGSSIVMLSIQDIVGIADRINTPG
TVSNQNWTFRFDAMPENIENIYPAQIQAYKKLITECNR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggttttaaacaaaagaagcgtaggtatagttatgcctttgtttgccatgcga
agcgtggcagactggggcgtgggcgattttgcttcaatgaaaaactggataaattattta
gcttccacaaaaacatctgttttacaaatccttccgataaacgaaatggcgccgcagcac
agctgcccgtataacgctatgacttcttttgctattgacccggtatatatttgtgttgag
gaagtgcaagatatcataaactcacctgaagcccaaagctttattaaaacaatacgcccg
gttgttgatatttggcaaaaatccgaaagagtgcattatgttaccatacgcgacgctaaa
ctaaaagcgttgtggaacgggttcggctattttttaactaatgaatggcttaaagacagc
gatagagccaaagagtttaaaaccttcttagcgcagcatgcccattggctagataactac
gctttatttagggctttaaaagattattttaaatggcaaagctggactttatggcccgaa
gagtttcaaaacgcggacaaaaacgctttagcgggttttgaaaaagattattttaaacag
gttttgttctttaaatatttacaatggatagctgaggaacaaataaaacaggttacttct
ttggcagcctctaaacaaatgtatattttcggcgatattccttttggcataaaccttgac
agcgctgacgtttgggccgaaagggataattttaataccgccgttgaagtgggcgcgccg
ccggaccagttttcaaccgaagggcagcactggggcatgccgggatataactggcttcac
atgcaggccacgggctatgaatactggaaaaggaaagtagggcgcgcatgcgaacttttt
gacattttcagattagaccattttgtaggattttttagaacttatatttataaatcgcag
gaagacaggggcgagtttgactggcttggcgaggacgcccaggcaaaaagaggttacgat
tttctagttgccattcaagaggcctcccgaggtaaacagtcagtaggcgaggatttgggc
gttataccagactatgtgaggagaataatggctgaccttaatatcccgggatataaaatt
atgcgctgggaacaggatagcggctattaccgcgaccccgccaaatacccttatatttca
atagccgctgtttcaacccatgatacggaaacgcttaaaggctggtgggaatcaataccc
cttgctgaccgcgcggacgtatgggaaatgatttcaggagttaaaacggatggaattatt
ccttttacgcaagaaattcaggaacaaattttaagaagacttatgaacagcggctcctcg
atagttatgctttcaatacaagatattgtgggcatcgctgaccgtattaatacgccgggc
accgtttctaaccaaaattggacgttccgtttcgacgctatgcccgagaatatagaaaat
atatatcccgcccaaatacaagcctataaaaaacttataacagagtgtaaccgctag

DBGET integrated database retrieval system