KEGG   Elusimicrobium minutum: Emin_0410Help
Entry
Emin_0410         CDS       T00741                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
emi  Elusimicrobium minutum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emin_0410
   01230 Biosynthesis of amino acids
    Emin_0410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emin_0410
   00030 Pentose phosphate pathway
    Emin_0410
   00051 Fructose and mannose metabolism
    Emin_0410
   00052 Galactose metabolism
    Emin_0410
  Energy metabolism
   00680 Methane metabolism
    Emin_0410
Enzymes [BR:emi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Emin_0410
Protein phosphatases and associated proteins [BR:emi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Emin_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
438847..439953
Genome map
AA seq 368 aa AA seqDB search
MTNKIRKIGILTAGGDCPGLNAVVRAVSKNALRQGIEVIGFKNGFEGLVKNEFIKINDFI
ASGILTLGGTILGTSNIANPFKYMQEPYGTPENPVDVSNIAIKNFEDNKLDALVTIGGDG
TLSMSQQFVEKGIPIVGVPKTIDNDLSATDQTFGFDSALAIATEAVDRIHTTAQSHHRAM
IVETMGRYAGWLALRSGIAGGGDIILIPEIPYSEDVIVQTIETRKAKGKNFSIIVVSEGA
KNESGEMVIAKTIAGSTDAIRLGGVGQRISQMIECRAGIESRYCILGHVQRGGSPTAYDR
LLSTRYGAKALDLIIEGKTKNMVSLQGTQIKDVLIKDAVSKLKLVDPHGQEVHAAVSIGT
SFGSKEIG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaataagaaaaataggcatacttaccgcagggggggactgcccgggactt
aacgcagtggtgcgcgcggtttctaaaaacgctttaagacaggggattgaagttataggt
tttaaaaacggttttgaggggttggttaaaaatgagtttattaaaattaacgattttata
gcttccggcatattgactttgggagggaccatactgggtacaagtaatatcgctaatcct
tttaaatatatgcaggaaccttacggcacgccggaaaaccctgtcgacgtttcaaatata
gcgattaaaaattttgaagacaacaaacttgacgctcttgtaactatagggggggacggc
actttatcaatgtcgcagcaatttgttgaaaagggtattcctatagtaggggtgcctaaa
actattgataatgacttgtccgccacggaccagacttttggttttgactccgctttagcg
atagctaccgaagcggttgacaggattcataccacggcccagtcccatcacagagctatg
attgttgaaaccatgggcagatacgccggctggcttgctttacgttcaggtatagcgggc
ggcggcgatattattttaatacccgaaattccttacagcgaggatgttatagttcaaact
attgaaacccgtaaagctaagggaaaaaatttcagtattatagtggtatccgaaggcgca
aaaaatgaaagcggtgaaatggttatagcaaaaactatagcgggatcaaccgacgctatc
agacttggcggcgtaggccagcgcataagccaaatgattgaatgccgcgcgggcattgaa
agccgctattgtattttaggccatgtgcagaggggcggttcccccaccgcgtatgacaga
ttgctttccacaagatacggcgctaaagcgcttgaccttataatagaaggcaaaacaaag
aacatggtttctttacagggaacccaaattaaagacgtgcttattaaagacgcggtttca
aaattaaaacttgttgacccgcacgggcaagaagtgcatgcagccgtttcaataggaaca
agtttcggctctaaggagattggttaa

DBGET integrated database retrieval system