KEGG   Elusimicrobium minutum: Emin_0501Help
Entry
Emin_0501         CDS       T00741                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
emi  Elusimicrobium minutum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Emin_0501
Enzymes [BR:emi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Emin_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
549751..550656
Genome map
AA seq 301 aa AA seqDB search
MNEASLKIFCPAKINLFLEIVSKLPNGYHELQTIFAKLDFGDNILLTLSPSDKTEINLKI
TGPYGHAITADADNLVYKAAQRFFEFTGISAKCDISLEKNIPTGAGLGGGSSDAGCLLRT
FCNHYKTDFTMLVPLAAKLGADVALFLYDEPVLKGEGIGEKLTPLKIKDALPYVVLSYPD
THISTKDVFDRLKVGSKEEILTNLAKLDKIIAGLTEGSAWEKYIYNRLEDYVLPFSKPVL
ELKKLMQTLGAKNIMMSGSGSTVFSLFDSSSDACAFAEKLINRGCVAVKTQLWRGLYNEN
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcttccttaaagatattctgtcccgctaaaataaatttatttttagagata
gtttccaaactgcctaacggttaccatgaactgcaaacaatttttgcaaagttagatttt
ggggataatattttactaaccctttctccgtcagataagacggaaatcaaccttaaaata
acaggcccctacgggcatgccataacggccgacgcggataaccttgtttataaggcggct
cagcgtttttttgaatttacaggcataagcgccaaatgcgatatatcgcttgaaaaaaat
attccgacaggcgcggggttggggggcggctcttcggatgcaggatgcctccttcgcact
ttttgcaaccattataagacagattttacaatgcttgttcctttggctgctaaactcggc
gcggacgtagcgttgtttctatatgacgaacctgttttaaaaggagaaggcataggtgaa
aaacttacgcctttaaaaattaaagacgcactgccttatgtggtgttgtcttacccagat
acgcacatatctactaaagatgtttttgataggctgaaggttggaagtaaagaagaaata
ttgacaaacttggctaagcttgataaaattatagctggtcttacagaaggaagtgcgtgg
gaaaaatacatatataacagattagaagattatgtattacctttcagtaagcctgttttg
gagttaaagaagttaatgcaaaccctaggagccaaaaatattatgatgtccggttccggt
tcaacagtttttagtttatttgatagttccagtgatgcctgtgcatttgctgaaaaatta
ataaatcggggttgtgttgcagtaaaaacgcaactttggaggggtttgtataatgaaaat
tactga

DBGET integrated database retrieval system