KEGG   Elusimicrobium minutum: Emin_0504Help
Entry
Emin_0504         CDS       T00741                                 

Definition
Holliday junction resolvasome DNA binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
emi  Elusimicrobium minutum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:emi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Emin_0504
Enzymes [BR:emi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Emin_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
553734..554342
Genome map
AA seq 202 aa AA seqDB search
MIGYLKGQILSLSEDSVLILVNGVGYEVNCAPVAVSALEEGQETALYIAESISPYDGTVL
YGFLTKEDKQLWAIFKTSIPNTGAKKALEYLNKALRSVADFHNAIVKKDPKILTGIFGFT
AKTAEKLIHSLDGKMDAVTIAGVPKIKIEGEAPFMSEVMMALTALGYSPMEARKAIDQLY
KTGLANDSVENIIRAALRILKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgataggttacttaaaggggcaaattttatctttatcggaagacagcgttctgatacta
gtaaacggggtgggctatgaagttaattgcgcgcccgtggcagtatcggccttagaagag
gggcaggaaaccgccctttatatagccgagtcaatttctccctatgacggaaccgtgcta
tacggttttttaactaaagaagacaaacagctttgggccatttttaaaacatctattccc
aatacaggcgctaaaaaggcgcttgaatatttaaataaagcgcttagaagcgtggcagat
tttcataacgctatagtaaaaaaagatcctaaaattttaacgggtattttcggttttacg
gctaaaacggctgaaaaacttatccattctttagacggcaagatggatgccgttacaata
gccggcgttcctaaaataaaaatagagggtgaagcgccttttatgtcagaagttatgatg
gcgttaaccgctttgggctacagccctatggaagccaggaaagctattgaccaactttac
aaaacaggtcttgccaatgacagcgttgaaaatattatcagggcggcattaaggatatta
aagaaatga

DBGET integrated database retrieval system