KEGG   Elusimicrobium minutum: Emin_0551Help
Entry
Emin_0551         CDS       T00741                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
emi  Elusimicrobium minutum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emin_0551
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emin_0551
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emin_0551
Enzymes [BR:emi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Emin_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
602508..603746
Genome map
AA seq 412 aa AA seqDB search
MTMLNPKKQISKPNTLIPNEHGFYGIYGGVFVPKELIVPLAEIADCFNNTAFTKEFQDEL
FYYYKNYVGRPSPLYYAANISCGGAKIYLKREDLNHTGAHKINHCIGEVLLAKKMGKKRV
IAETGAGQHGIAIATAAALLGIECVIYMGEQDVKKEYPNVLKIKTLGAKVVCVGSGAKGL
KEAVDAAFDDYLKDPETQMYAIGSVVGPHPFPLMVASFQSIVGKEAREQFLEQEGRLPDN
VVACVGGGSNSMGIFSGFFADKTVKLTGVEPAGKGLETGLHAAPLAKGRVGVVHGFKCYF
MQDDKGNPMGTHSVASGLDYLGVGPQHCYLKDSGRVTYRSACDDEAVDAFFMLSRKEGII
PALESAHAVAYALKLSKELGKDKSILVNLSGRGEKDLDYVLSLYGKKYGVDI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgttaaacccaaaaaaacagatatcaaaacccaacacattaattcctaacgaa
cacggtttttacggcatttacggcggcgtgtttgtgcctaaagaacttatcgtcccgctt
gccgaaatagcggactgctttaacaacacagcttttaccaaagaatttcaagacgaactt
ttttattactataaaaactatgtggggcggccttctcctttatattacgcggctaatatt
tcttgcggcggcgctaaaatatatttaaaaagggaagatcttaaccacacgggcgcgcat
aaaataaaccattgcataggagaggtattgctagccaaaaaaatgggtaaaaaaagagtt
atagctgaaacgggcgccgggcagcatggcatagccattgcaacggcggcggccttatta
ggtattgagtgtgtaatttatatgggcgagcaggatgttaaaaaagaatatcccaatgtg
cttaaaataaaaaccttgggagctaaagttgtttgcgtaggctcaggcgctaaaggatta
aaagaagctgtcgacgccgcttttgatgactatttaaaagatcccgaaacacaaatgtac
gctataggctccgttgtggggccgcacccttttcctttaatggtggcgtctttccaaagc
attgtcggtaaagaagccagagagcagtttttagagcaggaaggaaggctgcccgataat
gttgtggcgtgtgtagggggggggtctaactcaatgggtattttcagtgggttttttgct
gataaaaccgtaaaacttacaggcgtagagcccgcgggtaaaggtttggaaacaggcctt
cacgcggcgccgcttgccaaaggcagggttggcgtagtgcacggttttaaatgctatttt
atgcaagatgataaaggtaaccccatgggtacgcacagcgtagcaagcggacttgattac
ctgggtgtcgggccgcagcattgttatttaaaagactcgggccgggttacttaccggtcc
gcttgtgatgatgaggctgttgacgcgttttttatgctttcaagaaaggaaggcattata
cccgctttggaaagcgcgcacgccgttgcttacgctttaaaactttccaaagaattaggc
aaagacaaatcaattcttgttaatctttccggcaggggggaaaaggatttggattatgta
ttatctctttacggcaaaaaatacggcgttgatatataa

DBGET integrated database retrieval system