KEGG   Elusimicrobium minutum: Emin_0551Help
Entry
Emin_0551         CDS       T00741                                 

Definition
(GenBank) Tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
emi  Elusimicrobium minutum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emin_0551
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emin_0551
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emin_0551
Enzymes [BR:emi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Emin_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
602508..603746
Genome map
AA seq 412 aa AA seqDB search
MTMLNPKKQISKPNTLIPNEHGFYGIYGGVFVPKELIVPLAEIADCFNNTAFTKEFQDEL
FYYYKNYVGRPSPLYYAANISCGGAKIYLKREDLNHTGAHKINHCIGEVLLAKKMGKKRV
IAETGAGQHGIAIATAAALLGIECVIYMGEQDVKKEYPNVLKIKTLGAKVVCVGSGAKGL
KEAVDAAFDDYLKDPETQMYAIGSVVGPHPFPLMVASFQSIVGKEAREQFLEQEGRLPDN
VVACVGGGSNSMGIFSGFFADKTVKLTGVEPAGKGLETGLHAAPLAKGRVGVVHGFKCYF
MQDDKGNPMGTHSVASGLDYLGVGPQHCYLKDSGRVTYRSACDDEAVDAFFMLSRKEGII
PALESAHAVAYALKLSKELGKDKSILVNLSGRGEKDLDYVLSLYGKKYGVDI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgttaaacccaaaaaaacagatatcaaaacccaacacattaattcctaacgaa
cacggtttttacggcatttacggcggcgtgtttgtgcctaaagaacttatcgtcccgctt
gccgaaatagcggactgctttaacaacacagcttttaccaaagaatttcaagacgaactt
ttttattactataaaaactatgtggggcggccttctcctttatattacgcggctaatatt
tcttgcggcggcgctaaaatatatttaaaaagggaagatcttaaccacacgggcgcgcat
aaaataaaccattgcataggagaggtattgctagccaaaaaaatgggtaaaaaaagagtt
atagctgaaacgggcgccgggcagcatggcatagccattgcaacggcggcggccttatta
ggtattgagtgtgtaatttatatgggcgagcaggatgttaaaaaagaatatcccaatgtg
cttaaaataaaaaccttgggagctaaagttgtttgcgtaggctcaggcgctaaaggatta
aaagaagctgtcgacgccgcttttgatgactatttaaaagatcccgaaacacaaatgtac
gctataggctccgttgtggggccgcacccttttcctttaatggtggcgtctttccaaagc
attgtcggtaaagaagccagagagcagtttttagagcaggaaggaaggctgcccgataat
gttgtggcgtgtgtagggggggggtctaactcaatgggtattttcagtgggttttttgct
gataaaaccgtaaaacttacaggcgtagagcccgcgggtaaaggtttggaaacaggcctt
cacgcggcgccgcttgccaaaggcagggttggcgtagtgcacggttttaaatgctatttt
atgcaagatgataaaggtaaccccatgggtacgcacagcgtagcaagcggacttgattac
ctgggtgtcgggccgcagcattgttatttaaaagactcgggccgggttacttaccggtcc
gcttgtgatgatgaggctgttgacgcgttttttatgctttcaagaaaggaaggcattata
cccgctttggaaagcgcgcacgccgttgcttacgctttaaaactttccaaagaattaggc
aaagacaaatcaattcttgttaatctttccggcaggggggaaaaggatttggattatgta
ttatctctttacggcaaaaaatacggcgttgatatataa

DBGET integrated database retrieval system