KEGG   Elusimicrobium minutum: Emin_0633Help
Entry
Emin_0633         CDS       T00741                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
emi  Elusimicrobium minutum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:emi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
689973..690749
Genome map
AA seq 258 aa AA seqDB search
MKKPLIMGILNVTPDSFFDGGKTADPFVRASKLIEEGADIIDIGGESTRPGAEPVSFEDE
KKRVIPVLKQIKAAYPKITISIDTYKPKIAKLAVEEGADIINDPSGLADPVMADIAASSD
TKLVVMHTRGTPQNMDKLTEYADIVADIKNFFEKKIQECAREGLHTDNIILDPGFGFAKN
KEQNFLLLKNISYYKSLGLPLLIGLSRKKFLAKEGDTPADRLEATLSANLYAAMNGADIL
RVHDVAETIKILEKIPVS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgcttattatgggcattttaaacgttacgcccgactctttttttgacggc
ggcaaaaccgccgatccttttgtccgagcttctaaacttattgaagaaggcgccgatata
attgatatagggggggaatctacccgtccgggcgcggaacctgttagttttgaggatgaa
aaaaagcgcgtaatacctgttttaaagcaaattaaagcggcttaccctaaaataaccata
tccatagatacctataaacccaaaatagctaagctggcagttgaagaaggcgccgatatt
attaatgaccccagcggtcttgctgatcctgttatggcggacatagccgcctcttcagat
acaaaacttgttgttatgcacacaagaggcactccgcaaaatatggataagttaactgag
tatgcggacatcgttgccgatattaaaaacttttttgaaaaaaaaatacaagagtgcgca
agagaaggcctgcacacggataatattattttagaccccggtttcggttttgcaaaaaat
aaagagcaaaactttttgcttcttaaaaacataagctattacaaaagtctggggcttcct
ttgcttataggacttagcagaaaaaaattcttagctaaagaaggcgataccccggccgac
aggcttgaagctacactgtcagccaatttgtatgccgccatgaacggggccgatatatta
agagtgcatgacgtggccgaaaccattaaaatattggaaaaaattcctgttagttaa

DBGET integrated database retrieval system