KEGG   Elusimicrobium minutum: Emin_0634Help
Entry
Emin_0634         CDS       T00741                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
emi  Elusimicrobium minutum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:emi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(690823..691341)
Genome map
AA seq 172 aa AA seqDB search
MLAYIGDNPNREGLQETPHRIVKSWEKIFGGYKQKPESVLKTFVEGSCDEMVILKDIEFY
STCEHHFQPFFGTISIGYLPNKRVLGVSKLARLVEVFSRRLQIQEKLSADIADSLMQHLN
PLGVMVVCKARHMCVCSRGVEKHNAVMITSAIRGVFKKPEVRGEFLDFIQAN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcctacatcggcgacaatcccaaccgtgaaggtttgcaggaaaccccgcacagg
atagtaaaaagctgggaaaaaatttttggcgggtataaacaaaagccagaaagcgttcta
aaaacttttgtggaaggctcctgcgatgaaatggttattttaaaagatattgaattttat
tctacctgcgagcatcattttcagccgtttttcggcacgataagcataggttatcttccc
aacaaaagagttttgggcgtatcaaaactggcaaggcttgttgaagtattttcccgcaga
ttacagatacaggaaaagctttccgccgatatagcggactccttaatgcagcacttaaat
cccttaggagtaatggttgtttgtaaagcaagacatatgtgcgtttgcagcagaggggtt
gaaaaacataacgccgttatgataaccagcgctataagaggcgtgtttaaaaaacctgaa
gtaaggggagagtttttggactttatacaagccaattaa

DBGET integrated database retrieval system