KEGG   Elusimicrobium minutum: Emin_0725Help
Entry
Emin_0725         CDS       T00741                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
emi  Elusimicrobium minutum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Emin_0725
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Emin_0725
Enzymes [BR:emi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Emin_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
801220..802158
Genome map
AA seq 312 aa AA seqDB search
MTNKFVWTKKDLLGLEYLTAEELSHILETAEGFKEVSTRDIKKVPALRGKTAANLFYEPS
TRTRVSFEIAEKRLSCDVVNMDMKASSVLKGETLADTGRNLEALKIDIFVIRHHMAGAPN
VLSQFVNASVVNAGDGKHEHPTQALLDIYTLKEKFGSLKGLNVSIIGDISHSRVARSNIW
GLTKLGANVTLCAPEIILPHDFKQFGVKITSDLDEALKDAHAINVLRMQFERDNAAAFPS
PSQYYKQYGITKDRLKKHKKDIIVMHPGPINRGIEISSDVADGPNSVILDQVTNGIAVRM
AVLYLVSTAKRG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactaataaatttgtctggactaaaaaagaccttttgggtcttgaatacttaaccgct
gaggaactttcccatatacttgaaacggcagaaggttttaaagaagtttccacccgcgac
attaaaaaggtgcccgctttaaggggtaaaaccgcggctaacttattttacgagccttcc
acaagaacgcgcgtaagctttgaaattgcagaaaaaaggttatcctgcgatgttgttaat
atggatatgaaggcctcaagcgtgcttaaaggggaaacccttgctgacacggggcgcaat
ttagaagctttaaaaatagatatttttgtaatccgtcaccatatggcgggtgcgccaaat
gttttaagccaatttgtcaatgccagcgtagttaacgcgggggacggcaaacacgaacat
cctactcaggcattattagatatttatactttaaaagaaaagtttggctctttaaagggc
ctcaatgtaagcattataggcgatatttcgcattcaagggtagcccgctcaaacatatgg
gggcttaccaaattaggcgctaatgtaacgctttgcgcgcctgaaattatattaccgcac
gattttaagcaatttggcgtaaaaataaccagcgatttggacgaggccctaaaagacgcc
catgccattaacgtgctgagaatgcagtttgagcgcgataacgcggccgctttcccaagc
ccttcccagtattataaacaatacggaataacaaaggatcgccttaaaaaacataaaaaa
gacattattgttatgcatcccggtcctattaacaggggcatagaaataagttccgatgtg
gccgacggcccgaattccgtaattttagaccaagttacaaacggtatcgccgtaagaatg
gcggtattatatttagtttcaacggcaaaaagagggtaa

DBGET integrated database retrieval system