KEGG   Elusimicrobium minutum: Emin_0772Help
Entry
Emin_0772         CDS       T00741                                 

Definition
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
emi  Elusimicrobium minutum
Pathway
emi00010  Glycolysis / Gluconeogenesis
emi00071  Fatty acid degradation
emi00350  Tyrosine metabolism
emi00620  Pyruvate metabolism
emi00625  Chloroalkane and chloroalkene degradation
emi00626  Naphthalene degradation
emi00650  Butanoate metabolism
emi01100  Metabolic pathways
emi01110  Biosynthesis of secondary metabolites
emi01120  Microbial metabolism in diverse environments
emi01130  Biosynthesis of antibiotics
emi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emin_0772
   00620 Pyruvate metabolism
    Emin_0772
   00650 Butanoate metabolism
    Emin_0772
  Lipid metabolism
   00071 Fatty acid degradation
    Emin_0772
  Amino acid metabolism
   00350 Tyrosine metabolism
    Emin_0772
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Emin_0772
   00626 Naphthalene degradation
    Emin_0772
Enzymes [BR:emi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Emin_0772
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Emin_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACC98327
UniProt: B2KCT1
Position
complement(852588..855251)
Genome map
AA seq 887 aa AA seqDB search
MTNKEIKKGTKPVFTEADIAKEQAHIEHVLTSVKDAQKQYAQYTQEQVDKIFRAAAAAAA
SKRIFLSKMAVEETGMGVMEDKVIKNQFASEYIYNTYKNEQTCGVLERDQAFGFARVAEP
IGVIAGIIPTTNPTSTAIFKSLLALKTRNGIVFSPHPRAKKCTIAAAKIVLEAAVAAGAP
KNIIGWIEASSTKASEYLMKHDKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDS
TADIKMAVSSVIMSKTFDNGMICASEQSVIVEKSIAEEVKKEFVKRGCHFVTGKDREKLA
KTIVQDYHLNSKIVGQSAHKIAELAGFTVDPKTKILIAEAKDVNCDEPFAYEKLSPVLAF
YTVKDFYSGVELAQKLIEFGGAGHTSVLYTDEVNTEHISIFGEKLTTGRILINMPSSQGA
IGDVYNFKLVPSLTLGCGSWGGNSVSENIGVKHLMNIKSVAERRENMLWFRVPEKIYFKA
GATTLALEELKGRKRAFIITDKTMEQLGTVKNVAKVLAEAGIQVRIFSDVKPDPDLSNVR
EALELVNLFQPDILIGFGGGSPMDAAKIIWLMYEHPEVKFEDIALRFMDIRKRITAFPKL
GIKATMVAIPTTSGTGSEVTPFTVITDDASGIKYPIADYELTPKMAIIDPEYVMTMPKSL
TAFSGMDVVTHAVESYTSVFANNFTDGHALEALRLVFKYLRQSYNEGAKAPIAREKMHYA
ATIAGMAFANAFLGICHSMAHKIGGMYHTAHGLANAILLPYVIDYNATDNPVKQGLMPQY
KYPFVKGRYAKIADFLGITEGCGDDTDKKVMRLIEAIQKLNKDLGVPVSLQESGIPEAEF
LANLDALSEEAFDDQCTSGNPRYPLVSEIKDLYLKAYYGKPIKHKKN
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagagataaaaaaaggaacaaaaccggtttttaccgaagctgacatagct
aaagagcaagcacatatagaacatgttcttacttctgtaaaggacgctcaaaaacaatat
gcccagtatacgcaagaacaggttgataaaatcttccgcgcggcggcggccgcggcggct
tcaaaacgtattttcctttctaaaatggcagttgaagaaacgggtatgggcgttatggaa
gataaggttataaaaaaccaattcgcttcggaatatatttataatacatataaaaatgaa
caaacctgcggcgtacttgagagggaccaggccttcggtttcgcaagagtggccgaacct
ataggcgtaattgcgggtattattcccaccacgaaccctacgtcgacagctatttttaaa
tctcttttagctttaaaaacccgtaacggaatagttttttccccgcatcccagagctaaa
aaatgcacaatagcggcggctaaaatagtacttgaagccgctgtcgccgcgggcgcgcct
aaaaatattatcggctggattgaagcatcctcaaccaaagcgagcgaataccttatgaag
catgacaaggtaaacttaatacttgccacaggtggtccgggcatggttaaagccgcatac
agttcaggcaagcccgctatcggcgtgggtgccggcaacacccctgtagtcatagattca
acagccgatattaaaatggcggtaagttccgttattatgagtaaaacctttgataacggc
atgatttgcgccagcgaacaaagcgttattgttgaaaagtccatagccgaagaggtcaaa
aaagaatttgttaaaagaggctgccactttgttacaggtaaagaccgtgaaaaacttgcc
aaaactatagtgcaagactatcatcttaattctaaaatagtagggcaaagcgctcataaa
atagccgagttggcgggttttacggttgacccaaaaacaaaaatattaatcgccgaggcc
aaagacgtaaattgtgacgagcctttcgcttatgaaaaactttcgcccgtgctcgctttt
tacacggttaaagatttttattcgggcgttgagcttgcgcaaaaattaatagaattcggc
ggagcggggcatacctcggttctttataccgatgaagtaaatacggaacatatctctatt
ttcggcgaaaaacttacaacaggccgcatccttattaatatgccttcttcacagggggct
ataggcgatgtgtacaattttaagcttgtcccctcgctcacattgggctgcggctcatgg
ggtggcaactcggtaagtgaaaatataggagttaaacatcttatgaacataaaatcagta
gcggaaagacgcgaaaatatgctttggttcagagtgccggaaaaaatttatttcaaggca
ggagcgacaaccctggctttagaagaacttaaaggccgtaagcgcgcttttataataacg
gataaaaccatggaacagcttggcacggttaaaaatgtagctaaagttttggcggaagcg
ggtatacaggtgcgtattttcagcgacgttaaacccgacccggatctttccaacgtgcgt
gaggcgttagagcttgttaacctttttcagccggatattttaataggttttggcggcggg
tcccctatggatgcggcaaaaataatttggcttatgtatgaacacccggaagttaagttt
gaagatatagctttaagatttatggatatcagaaaacgtattacggcttttccaaaattg
ggtattaaagcgacaatggttgctataccgaccacttcgggtacaggttctgaagtaacg
ccttttaccgttattacggacgacgcttcaggtataaaatatcctatagccgattatgag
ttaacgcctaaaatggctattattgacccggaatatgttatgacaatgcctaaaagcctg
accgctttttccggtatggatgttgttacccacgctgttgagtcttatacctctgttttt
gccaacaattttacggacggacacgctttggaagctttaaggcttgtgtttaaatattta
cgtcagtcttataatgaaggagctaaagcgcctatagcgcgtgagaaaatgcattatgcc
gccacaatagccggtatggcttttgctaacgcgtttttgggtatatgtcattccatggcg
cataaaataggcggtatgtatcatacggcgcacggtttagccaacgccatacttttgccc
tatgttattgattataatgcaactgacaaccctgtaaaacaaggtttaatgccgcaatat
aaatacccgtttgttaaagggcgttatgccaaaatagctgattttctgggcattacggaa
ggctgcggggatgatacagataaaaaagtaatgcgtcttattgaagctatacaaaaactt
aataaagatttaggagttcccgtttctttacaggaaagcggcatacctgaagcggaattt
ttagctaaccttgacgcgctttccgaagaggcgtttgacgaccagtgcacaagcggcaat
ccgcgttatcctttggtaagcgaaattaaagatctttacttaaaagcctattacggtaag
cctataaaacacaaaaaaaattaa

DBGET integrated database retrieval system