KEGG   Elusimicrobium minutum: Emin_0837Help
Entry
Emin_0837         CDS       T00741                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
emi  Elusimicrobium minutum
Pathway
emi00230  Purine metabolism
emi01100  Metabolic pathways
Module
emi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Emin_0837
Enzymes [BR:emi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Emin_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin Viral_helicase1 cobW SOUL AAA_33 AAA_18 MMR_HSR1 T2SSE AAA_16 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACC98392
UniProt: B2KCZ6
Position
922258..922863
Genome map
AA seq 201 aa AA seqDB search
MDAFVLIVSSPSGGGKTTIVNELLKKDRTAKRVVTATTRSPRKGEKDGKDYHFWSVKKFQ
SAIKNNKMAEWANVFTDYYGVPKESLDTVLKKGLIPVLVIDVQGQKSIKKHYKNAVSVFI
LPPSWNELKKRLLARPGGTNNIDVRLKTAKKEVAQVKKFDYVIVNDKLDGAVNALSKIIF
AEKHKTQRKKPAINRLKQKRR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttttgtacttatagtctcttcgccttcaggcggagggaaaacaactatagtt
aacgaacttcttaaaaaagaccgcactgctaagagggtggtaaccgccacaacccgctcg
cctagaaaaggcgaaaaagacgggaaggattatcatttttggtctgttaaaaagtttcaa
agcgctatcaaaaataacaaaatggccgagtgggccaacgtatttaccgactactacggc
gtgcctaaagaatctttggacaccgtgttaaaaaaaggtttaatacccgttttggttata
gacgtgcaaggccaaaaatcaataaaaaaacattataagaacgccgtaagcgtttttata
ctgccgccaagctggaatgagcttaaaaaaagacttttggcaagacccggcggaacaaat
aatattgatgtgcgtcttaaaacggcaaagaaagaagttgcccaggtaaaaaagtttgat
tatgttatcgttaacgataaacttgacggcgcggttaacgcgttatcaaaaataattttt
gcggaaaaacataaaacccaaagaaaaaagcccgccataaacaggcttaagcaaaaacgg
agataa

DBGET integrated database retrieval system