KEGG   Elusimicrobium minutum: Emin_1070Help
Entry
Emin_1070         CDS       T00741                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
emi  Elusimicrobium minutum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Emin_1070
Enzymes [BR:emi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Emin_1070
Exosome [BR:emi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Emin_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1164519..1165964
Genome map
AA seq 481 aa AA seqDB search
MNTEKNYLVLDQGSSGSRVFIVNAEGKTLHKKYRELTPKHLGLNLAEYDGEELLLQQFNL
LEEIMQQNPGGKIKSMAVSSQRSTIVLWDKNTGKTLCPVLTWQDGRGAEYANKVKMSQEE
IHAKTGLYKTPFYSASKITWCLNNYPQAKKAAEEGALLIAPVATFVIWHLTGKKVFAVDP
TLAQRTLLFNINTFTWDDDLIAAFNIPKNALPEIKNTVDNYGSYKGIPIKVCVGDQQSAA
IGIGSEKEGDAIINYGTGAFLLVNTDKNLKSIPGLLTSVGPSTKTNPKNFMLEGPVNAAS
AIFQWLNSVGINFDLNDIDDIYQRSKNPVYFLPAFGGIGAPYWDFETPTVMAGFTTASKK
EDIIAGGVNSLVFMLADIAFYIQKANVKIDNVKVSGGFAKNHSLLQFQADILNTKLTQTC
ENETTAMGAVCLMAKEDGVDVSSWEIFNAHRVINPQITALEAMDLYQKWHRFFDWCRSFK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagaaaaaaattatcttgtgctggaccaggggtccagcgggtcgcgcgttttt
attgtaaacgccgagggcaaaacactccataaaaaataccgggagcttaccccaaaacac
ttaggccttaacttggccgaatacgacggggaggagcttttgctccagcaatttaacctg
cttgaggaaataatgcagcaaaatcccggcggtaaaataaaatcaatggcggtttccagc
cagcgctcgacaatagttttgtgggataaaaatactggcaaaaccttatgccccgtttta
acctggcaagacggccgcggagccgaatacgcaaataaagtaaaaatgagccaggaagaa
attcacgcaaaaacgggtttatataaaacgccgttttattcggcttctaaaataacatgg
tgtttaaataactatccccaggccaaaaaggcggctgaggaaggcgcccttttaatagcg
cctgtggccacttttgtaatatggcatctgactggtaaaaaagtttttgcggttgaccct
actttagcgcaaagaacgctgctttttaacattaacacttttacctgggatgacgacctt
attgccgcttttaatatacccaaaaatgctttgcccgaaataaaaaataccgttgataat
tacggcagttataaaggaataccgataaaagtatgcgtgggggaccagcagtccgccgcc
ataggcataggatctgaaaaagaaggcgacgctattataaactacggcacaggcgctttt
ttacttgttaacacggataaaaatttaaaaagtataccgggccttttaacttctgtaggg
ccgtccacaaaaactaacccgaaaaattttatgcttgaaggccccgttaacgcggcaagc
gccattttccaatggcttaacagcgtaggcataaattttgatttaaatgatatagacgat
atttaccaaagaagcaaaaaccccgtttatttcctgccagctttcggcggaataggcgcg
ccttactgggattttgaaacgcctaccgtaatggccgggtttacaacggcaagcaaaaag
gaagatattatagcaggcggcgttaacagccttgtttttatgcttgccgacatcgctttt
tacattcaaaaagccaatgtaaaaattgataatgttaaagtatcgggcgggtttgcaaaa
aaccattctcttttgcaattccaggctgatattttaaacacaaagctcacccaaacctgc
gaaaacgaaaccaccgccatgggcgccgtatgtcttatggctaaagaagacggagttgac
gtgtcttcttgggaaatttttaacgcccacagggtaattaaccctcaaattactgcgctt
gaagccatggatttataccaaaaatggcaccgtttttttgactggtgcagaagttttaaa
aaataa

DBGET integrated database retrieval system